Basic Vector Information
- Vector Name:
- GAANTRY P donor luc
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10247 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Collier R, Thomson JG, Thilmony R.
- Promoter:
- sacB
GAANTRY P donor luc vector Map
GAANTRY P donor luc vector Sequence
LOCUS 40924_979 10247 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector GAANTRY P donor luc, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 10247)
AUTHORS Collier R, Thomson JG, Thilmony R.
TITLE GAANTRY, a versatile and robust Agrobacterium-based gene stacking
system generates high quality transgenic plants
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 10247)
AUTHORS Thilmony R.
TITLE Direct Submission
JOURNAL Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit,
USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA
REFERENCE 3 (bases 1 to 10247)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10247)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-DEC-2017) Crop Improvement and Genetics research Unit,
USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..10247
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 51..72
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 87..117
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 125..141
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 149..165
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
regulatory complement(204..456)
/label=nos terminator
/note="nos terminator"
/regulatory_class="terminator"
terminator 204..456
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
CDS complement(514..2163)
/label=luciferase
/note="firefly luciferase"
CDS complement(2170..2400)
/codon_start=1
/gene="ubq"
/product="ubiquitin monomer"
/label=ubq
/note="potato ubiquitin monomer; translational fusion
confers enhanced expression"
/protein_id="AWK49540.1"
/translation="MQIFVKTLTGKTITLEVEGSDTIDNVKAEIQDKEGIPPDQQRLIF
AGKQLEDGRTLADYNIQKESTLHLVLRLRGGG"
gene complement(2170..2400)
/gene="ubq"
/label=ubq
regulatory complement(2401..3779)
/label=potato 409S ubiquitin promoter and 5' intron
/note="potato 409S ubiquitin promoter and 5' intron"
/regulatory_class="promoter"
misc_feature 3887..3942
/label=A118 attP
/note="A118 attP"
misc_feature 3979..4003
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
CDS 4335..5126
/label=KanR
/note="aminoglycoside phosphotransferase"
misc_feature 5321..5426
/label=ParA MRS
/note="ParA MRS"
primer_bind complement(5449..5465)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 5473..5489
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(5497..5527)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(5542..5563)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 5796..6241
/label=sacB promoter
/note="sacB promoter and control region"
CDS 6242..7660
/label=SacB
/note="secreted levansucrase that renders bacterial growth
sensitive to sucrose"
rep_origin complement(7761..8349)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(8523..9380)
/label=AmpR
/note="beta-lactamase"
promoter complement(9381..9485)
/label=AmpR promoter
rep_origin complement(9511..9966)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 10108..10124
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 10133..10197
/label=TP901 attP
/note="TP901 attP"
This page is informational only.