Basic Vector Information
- Vector Name:
- GAANTRY B helper
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6338 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Collier R, Thomson JG, Thilmony R.
GAANTRY B helper vector Map
GAANTRY B helper vector Sequence
LOCUS 40924_969 6338 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector GAANTRY B helper, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6338) AUTHORS Collier R, Thomson JG, Thilmony R. TITLE GAANTRY, a versatile and robust Agrobacterium-based gene stacking system generates high quality transgenic plants JOURNAL Unpublished REFERENCE 2 (bases 1 to 6338) AUTHORS Thilmony R. TITLE Direct Submission JOURNAL Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit, USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA REFERENCE 3 (bases 1 to 6338) TITLE Direct Submission REFERENCE 4 (bases 1 to 6338) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit, USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6338 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(3..458) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" primer_bind 633..649 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 669..690 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 705..735 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 743..759 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 779..1447 /codon_start=1 /gene="ParA" /product="ParA" /label=ParA /note="small serine site-specific recombinase" /protein_id="AWK49527.1" /translation="MATREQQPEGRRLKVARIYLRASTDEQNLERQESLVAATRAAGYY VAGIYREKASGARADRPELLRMIADLQPGEVVVAEKIDRISRLPLAEAERLVASIRAKG AKLAVPGVVDLSELAAEANGVAKIVLESVQDMLLKLALQMARDDYEDRRERQRQGVQLA KAAGRYTGRKRDAGMHDRIIALRSGGSSIAKTAKLVGCSPSQVKRVWAAWNAQQQNKRA " gene 779..1447 /gene="ParA" /label=ParA CDS 1455..2813 /codon_start=1 /gene="A118" /product="A118" /label=A118 /note="A118 large serine site-specific recombinase" /protein_id="AWK49528.1" /translation="MKAAIYIRVSTQEQVENYSIQAQTEKLTALCRSKDWDVYDIFIDG GYSGSNMNRPALNEMLSKLHEIDAVVVYRLDRLSRSQRDTITLIEEYFLKNNVEFVSLS ETLDTSSPFGRAMIGILSVFAQLERETIRDRMVMGKIKRIEAGLPLTTAKGRTFGYDVI DTKLYINEEEAKQLQLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGY VSYKDKVHVKGIHEPIISEEQFYRVQEIFTRMGKNPNMNRDSASLLNNLVVCSKCGLGF VHRRKDTMSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIINRVNNYSFASR NVDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYESQIEA NEELKKNKKIQENLADLATVDFDSLEFREKQLYLKSLINKIYIDGEQVTIEWL" gene 1455..2813 /gene="A118" /label=A118 regulatory 2820..2868 /label=T3 transcriptional terminator /note="T3 transcriptional terminator" /regulatory_class="terminator" promoter 2888..2992 /label=AmpR promoter CDS 3002..4081 /label=lacI /note="lac repressor" terminator 4084..4131 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" primer_bind complement(4189..4205) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4213..4229) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4237..4267) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4282..4303) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4591..5179) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5353..6210) /label=AmpR /note="beta-lactamase" promoter complement(6211..6315) /label=AmpR promoter
This page is informational only.