GAANTRY B donor MoroMYB vector (V009977)

Download GeneBank File(.gb)

LOCUS       40924_949        9281 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector GAANTRY B donor MoroMYB, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9281)
  AUTHORS   Collier R, Thomson JG, Thilmony R.
  TITLE     GAANTRY, a versatile and robust Agrobacterium-based gene stacking 
            system generates high quality transgenic plants
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 9281)
  AUTHORS   Thilmony R.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-DEC-2017) Crop Improvement and Genetics research Unit,
            USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA
REFERENCE   3  (bases 1 to 9281)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9281)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (15-DEC-2017) Crop Improvement and Genetics research Unit, 
            USDA-ARS-WRRC, 800 Buchanan Street, Albany, CA 94710-1105, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..9281
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      complement(7..218)
                     /label=CaMV 35S terminator
                     /note="CaMV 35S terminator"
                     /regulatory_class="terminator"
     CDS             complement(join(232..772,1568..1697,1795..1912))
                     /codon_start=1
                     /product="Moro MYBA"
                     /label=Moro MYBA
                     /note="derived from Citrus sinensis"
                     /protein_id="AWK49560.1"
                     /translation="MADSLGVRKGAWTGEEDDLLRKCIEKYGEAKWHQVPLRAGLHRCR
                     KSCRLRWLNYLNPNIKRGEFAADEVDLILRLHKLLGNRWSLIVGRLPGRTANDVKNFWN
                     THLRKKVDKCCKNNKEMKAKAEKVEKINIIKPQPRTFAKNSQWLKGKGMTSNNLQLGDY
                     NLGKQSTPSDHHHHHQQQQENETESVWWESFLFGDELDQQGISSSLSRPEEESTTANIF
                     AEKSPVVTKVTENRVIEAGQSCPTDDFAFDAELWDLLNAK"
     regulatory      complement(1924..3163)
                     /label=Arabidopsis HotHead (HTH) promoter
                     /note="Arabidopsis HotHead (HTH) promoter"
                     /regulatory_class="promoter"
     misc_feature    3224..3278
                     /label=TP901 attB
                     /note="TP901 attB"
     misc_feature    3300..3324
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     promoter        3483..3511
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     misc_feature    3552..3657
                     /label=ParA MRS
                     /note="ParA MRS"
     CDS             3700..4230
                     /label=GmR
                     /note="gentamycin acetyltransferase"
     misc_feature    4309..4414
                     /label=ParA MRS
                     /note="ParA MRS"
     primer_bind     complement(4437..4453)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4461..4477)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4485..4515)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4530..4551)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        4784..5229
                     /label=sacB promoter
                     /note="sacB promoter and control region"
     CDS             5230..6648
                     /label=SacB
                     /note="secreted levansucrase that renders bacterial growth 
                     sensitive to sucrose"
     rep_origin      complement(6749..7337)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7511..8368)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(8369..8473)
                     /label=AmpR promoter
     rep_origin      complement(8499..8954)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     9096..9112
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"