Basic Vector Information
- Vector Name:
- DH6-56
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5883 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Huang DC, Holtz WJ, Maharbiz MM.
DH6-56 vector Map
DH6-56 vector Sequence
LOCUS 40924_615 5883 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector DH6-56, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5883) AUTHORS Huang DC, Holtz WJ, Maharbiz MM. TITLE A genetic bistable switch utilizing nonlinear protein degradation JOURNAL J Biol Eng 6 (1), 9 (2012) PUBMED 22776405 REFERENCE 2 (bases 1 to 5883) AUTHORS Huang DC, Holtz WJ, Maharbiz MM. TITLE Direct Submission JOURNAL Submitted (10-JUN-2012) Electrical Engineering and Computer Sciences, University of California, Berkeley, 656 Sutardja Dai Hall, Berkeley, CA 94720, USA REFERENCE 3 (bases 1 to 5883) TITLE Direct Submission REFERENCE 4 (bases 1 to 5883) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J Biol Eng"; date: "2012"; volume: "6"; issue: "1"; pages: "9" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-JUN-2012) Electrical Engineering and Computer Sciences, University of California, Berkeley, 656 Sutardja Dai Hall, Berkeley, CA 94720, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: GENtle v. 1.9.4 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5883 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind complement(15..36) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(52..1131) /label=lacI /note="lac repressor" promoter complement(1132..1209) /label=lacI promoter protein_bind 1502..1518 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." protein_bind 1525..1541 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." 5'UTR 1569..1602 gene 1603..4002 /gene="mfLon" /label=mfLon CDS 1603..3999 /codon_start=1 /gene="mfLon" /product="mf-Lon with ssrA degrdation tag LVA" /label=mfLon /protein_id="AFN88256.1" /translation="MSKKIKLPIFQIRGSFIVPGIKENLEVGRKNTLASVNYAIKNSNN QMIAIPQIDASVEKPEFSDLHEFGILIDFEVIKEWKDNSLTISTNPIQRCKVISFFENE DQVPYAEVELIESINDFSDEELKELIEKISDAIKTKASLVTKQIKQLISGESDDLSLAF DSIMFKLAPSKILTNPEYITSPSLKTRWSIIEKIIFAEDGIITRNAESIDAARQKNEIE QELNHKLKEKMDKQQKEYYLREKMRIIKDELEDEDDSDDSSLEKYKERLAKEPFPEEVK RKIMASIKRVEALQSGTPEWNTEKNYIDWMMSIPWWEETEDLTDLKYAKKILDKHHYGM KKVKERIIEYLAVKTKTKSLKAPIITLVGPPGVGKTSLAKSIAEAVGKNFVKVSLGGVK DESEIRGHRKTYVGSMPGRIIQTMKRAKVKNPLFLLDEIDKMASDHRGDPASAMLEVLD PEQNKEFSDHYIEEPYDLSQVMFIATANYPEDIPEALYDRMEIINLSSYTEIEKVKIAQ DYLVPKAIEQHELTSEEISFTEGAINEIIKYYTREAGVRQLERHINSIIRKYIVKNLNG EMDKIVIDEKQVNDLLGKRIFDHTEKQEESQIGVVTGLAYTQFGGDILPIEVSLYPGKG NLILTGKLGEVMKESATIALTYVKSNFEKFGVDKKVFEENDIHVHVPEGAVPKDGPSAG ITITTALISALSDKPVSKEIGMTGEITLRGNVLPIGGLREKSISASRSGLKTIIIPKKN ERDLDEIPDEVKAKLKIIPAEKYEEVFAIVFKTKAANDENYALVA" misc_feature 3964..3996 /gene="mfLon" /label=degradation tag /note="degradation tag" CDS 3964..3996 /codon_start=1 /product="C-terminal peptide that mediates degradation in bacteria through the ClpXP and ClpAP proteases (McGinness et al., 2006)" /label=ssrA tag (LVA) /note="mutant LVA variant that confers accelerated degradation under some conditions (Andersen et al., 1998)" /translation="AANDENYALVA" terminator 4035..4106 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 4122..4149 /label=T7Te terminator /note="phage T7 early transcription terminator" rep_origin complement(4307..4895) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(4983..5077) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(5101..5757) /label=CmR /note="chloramphenicol acetyltransferase" promoter complement(5758..5860) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase"
This page is informational only.