Basic Vector Information
- Vector Name:
- cp9
- Antibiotic Resistance:
- Gentamicin
- Length:
- 5473 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Elias AF, Bono JL, Kupko JJ III, Stewart PE, Krum JG, Rosa P.
- Promoter:
- lac
cp9 vector Map
cp9 vector Sequence
LOCUS 40924_510 5473 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector cp9, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5473) AUTHORS Elias AF, Bono JL, Kupko JJ III, Stewart PE, Krum JG, Rosa P. TITLE New antibiotic resistance cassettes suitable for genetic studies in Borrelia burgdorferi JOURNAL Unpublished REFERENCE 2 (bases 1 to 5473) AUTHORS Krum JG, Bono JL, Elias AF, Rosa P. TITLE Direct Submission JOURNAL Submitted (26-NOV-2002) LHBP, RML, NIAID, NIH, 903 South 4th Street, Hamilton, MT 59840, USA REFERENCE 3 (bases 1 to 5473) TITLE Direct Submission REFERENCE 4 (bases 1 to 5473) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-NOV-2002) LHBP, RML, NIAID, NIH, 903 South 4th Street, Hamilton, MT 59840, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5473 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 71..659 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" repeat_region 790..973 /label=Borrelia burgdorferi IR2 /note="Borrelia burgdorferi IR2" CDS complement(1178..1738) /codon_start=1 /product="unknown" /label=unknown /note="Orf3; from Borrelia burgdorferi N40 plasmid cp9" /protein_id="AAO62542.1" /translation="MEKKRVVKVLTKKIDTYVEQNLMINESKISYYKTLKEKLNDNFKK EIFHRVENIKILKEIKDNQYYKFDGYKTFLDFIKDFDVAKTQAYKYLRLATALQEGLIK EDYLIENGIKNSYNFIKDKESPALKKSRQNPIKPLRFQLKTQESYDFYKKKSKFTSFMM HEIFENQKDFLKKLLKKYEELKI" CDS complement(1790..2341) /codon_start=1 /product="unknown" /label=unknown /note="Orf2; from Borrelia burgdorferi N40 plasmid cp9" /protein_id="AAO62541.1" /translation="MKIGLKAARINEQKIKFPKESIFLLKEKKGDKNIYHTKILKALHR VVSNKQKRCIIFFEKLLDKSEIQKLYLYPMKDGDKFLGIYYGYRKPINNVFVKYEINGV ENVYTFSKIYYIEFRFKTGSVCCYLKNMRRLLRKEKIDTPYNKAIVDKFIDLEKHVYEF YNKKYSSEGLILKWILKNLK" CDS complement(2351..3478) /codon_start=1 /product="unknown" /label=unknown /note="Orf1; from Borrelia burgdorferi N40 plasmid cp9" /protein_id="AAO62540.1" /translation="MENLSNINKTSKTTTCYNKLQYKLVVLISTLAYINKTYKKYTQKN ILYYFNENLKRNSQTPVKLKTLQNYLYKLEKEFKVTTNYHKHLGVNLGTEIYYQLNFSK KECYQKIYKYFQEKKDLRFQNRVSRGLKDRFTKNGSVDLKECLNNKNNIKEERKINEIE KYQVRNYFNKCNFLCKKILSIFLTILFNLNIDKDNIIKILKIIKIIEIKLLKNKNIHFT KSCMKEKQEKLKEILCNTQKEFEKNEYNSKQLETSFQKIYENYKFKPHFIIESHKYSDL NNIKRKLEKSIERKKENSQQNYQDLKTNIFNILIEQLKKEVNIELLKPIIKEYLNNQKK IEYNKVFCTYYCELLELMKNQKSLLSLKELNRKAI" repeat_region 3709..3892 /label=Borrelia burgdorferi IR1 /note="Borrelia burgdorferi IR1" protein_bind 4142..4163 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 4178..4208 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 4216..4232 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 4240..4256 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 4266..4322 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(4326..4342) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" regulatory 4498..4907 /label=FlgB promoter /note="FlgB promoter" /regulatory_class="promoter" CDS 4908..5438 /label=GmR /note="gentamycin acetyltransferase"
This page is informational only.