Basic Vector Information
- Vector Name:
- CasYFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10437 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hahn F, Mantegazza O, Greiner A, Hegemann P, Eisenhut M, Weber AP.
- Promoter:
- T3
CasYFP vector Vector Map
CasYFP vector Sequence
LOCUS 40924_435 10437 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector CasYFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10437) AUTHORS Hahn F, Mantegazza O, Greiner A, Hegemann P, Eisenhut M, Weber AP. TITLE An Efficient Visual Screen for CRISPR/Cas9 Activity in Arabidopsis thaliana JOURNAL Front Plant Sci 8, 39 (2017) PUBMED 28174584 REFERENCE 2 (bases 1 to 10437) AUTHORS Hahn F, Mantegazza O, Eisenhut M, Greiner A, Hegemann P, Weber APM. TITLE Direct Submission JOURNAL Submitted (03-NOV-2016) Plant Biochemistry, Heinrich Heine University Dusseldorf, Universitatsstr. 1, Dusseldorf 40225, Germany REFERENCE 3 (bases 1 to 10437) TITLE Direct Submission REFERENCE 4 (bases 1 to 10437) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Front Plant Sci 8, 39 (2017)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-NOV-2016) Plant Biochemistry, Heinrich Heine University Dusseldorf, Universitatsstr. 1, Dusseldorf 40225, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10437 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 4..362 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind complement(385..401) /label=SK primer /note="common sequencing primer, one of multiple similar variants" misc_RNA complement(785..860) /label=gRNA scaffold /note="guide RNA scaffold for the Streptococcus pyogenes CRISPR/Cas9 system" regulatory complement(881..1380) /label=U6/C8 /note="U6/C8" /regulatory_class="promoter" regulatory 1441..2254 /label=from Chlamydomonas reinhardtii /note="from Chlamydomonas reinhardtii" /regulatory_class="promoter" CDS 2273..2293 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" CDS 2291..6394 /label=Cas9 /note="Cas9 (Csn1) endonuclease from the Streptococcus pyogenes Type II CRISPR/Cas system" CDS 6401..7114 /label=EYFP /note="enhanced YFP" CDS 7130..7186 /codon_start=1 /product="2A peptide from porcine teschovirus-1 polyprotein" /label=P2A /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="ATNFSLLKQAGDVEENPGP" CDS 7187..7987 /codon_start=1 /product="aminoglycoside 3'-phosphotransferase VIII" /function="Selection marker in Chlamydomonas reinhardtii" /label=aminoglycoside 3'-phosphotransferase VIII /note="selection marker aminoglycoside 3'-phosphotransferase gene (aph) from Streptomyces rimosus" /protein_id="AQN67803.1" /translation="DDALRALRGRYPGCEWVVVEDGASGAGVYRLRGGGRELFVKVAAL GAGVGLLGEAERLVWLAEVGIPVPRVVEGGGDERVAWLVTEAVPGRPASARWPREQRLD VAVALAGLARSLHALDWERCPFDRSLAVTVPQAARAVAEGSVDLEDLDEERKGWSGERL LAELERTRPADEDLAVCHGDLCPDNVLLDPRTCEVTGLIDVGRVGRADRHSDLALVLRE LAHEEDPWFGPECSAAFLREYGRGWDGAVSEEKLAFYRLLDEFF" regulatory 7991..8230 /regulatory_class="terminator" promoter complement(8249..8267) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(8288..8304) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 8312..8328 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(8336..8366) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(8381..8402) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(8690..9278) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(9452..10309) /label=AmpR /note="beta-lactamase" promoter complement(10310..10414) /label=AmpR promoter
This page is informational only.