Basic Vector Information
- Vector Name:
- Aqp3a_WT-Strep
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5310 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Eskova A, Chauvigne F, Maischein HM, Ammelburg M, Cerda J, Nusslein-Volhard C, Irion U.
- Promoter:
- CMV
Aqp3a_WT-Strep vector Map
Aqp3a_WT-Strep vector Sequence
LOCUS 40924_285 5310 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector Aqp3a_WT-Strep, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5310) AUTHORS Eskova A, Chauvigne F, Maischein HM, Ammelburg M, Cerda J, Nusslein-Volhard C, Irion U. TITLE Gain-of-function mutations of mau/DrAqp3a influence zebrafish pigment pattern formation through the tissue environment JOURNAL Development (2017) In press PUBMED 28506994 REFERENCE 2 (bases 1 to 5310) AUTHORS Eskova A. TITLE Direct Submission JOURNAL Submitted (21-DEC-2016) e-CNV group, Max Planck Institute for Developmental Biology, Spemannstr. 35-39, Tuebingen 72076, Germany REFERENCE 3 (bases 1 to 5310) TITLE Direct Submission REFERENCE 4 (bases 1 to 5310) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Development (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-DEC-2016) e-CNV group, Max Planck Institute for Developmental Biology, Spemannstr. 35-39, Tuebingen 72076, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5310 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 42..421 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 422..625 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 2094..2117 /codon_start=1 /label=Strep-Tag II /note="peptide that binds Strep-Tactin(R), an engineered form of streptavidin" /translation="WSHPQFEK" CDS 2124..2147 /codon_start=1 /label=8xHis /note="8xHis affinity tag" /translation="HHHHHHHH" polyA_signal 2186..2241 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" promoter 3410..3514 /label=AmpR promoter CDS 3515..4372 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 4546..5134 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.