Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V013705 | pCDH-CMV-Fluc-EF1a-CopGFP-T2A-Puro-WPRE | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pCDH-CMV-Fluc-EF1a-CopGFP-T2A-Puro-WPRE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9837 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells, Lentivirus
- Selection Marker:
- Puro
- Promoter:
- EF-1α core
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
pCDH-CMV-Fluc-EF1a-CopGFP-T2A-Puro-WPRE vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pCDH-CMV-Fluc-EF1a-CopGFP-T2A-Puro-WPRE vector Sequence
LOCUS pCDH-CMV-Fluc-EF 9837 bp DNA circular SYN 20-OCT-2024 DEFINITION Exported. ACCESSION V013705 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9837) TITLE Direct Submission REFERENCE 2 (bases 1 to 9837) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..9837 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 6..233 /label=RSV promoter /note="Rous sarcoma virus enhancer/promoter" LTR 234..414 /label=5' LTR (truncated) /note="truncated 5' long terminal repeat (LTR) from HIV-1" misc_feature 458..583 /label=HIV-1 Psi /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1076..1309 /label=RRE /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 1493..1537 /label=gp41 peptide /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 1686..1727 /label=Protein Tat /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" misc_feature 1798..1915 /label=cPPT/CTS /note="central polypurine tract and central termination sequence of HIV-1" promoter 2005..2208 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 2297..3946 /codon_start=1 /label=luciferase /note="firefly luciferase" /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA HIEVNITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP ANDIYNERELLNSMNISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV FVDEVPKGLTGKLDARKIREILIKAKKGGKSKL" promoter 3996..4207 /label=EF-1-alpha core promoter /note="core promoter for human elongation factor EF-1-alpha" LTR 4220..4488 /label=5' LTR (truncated) /note="truncated 5' long terminal repeat (LTR) from human T-cell leukemia virus (HTLV) type 1" CDS 4544..5209 /label=CopGFP /note="green fluorescent protein 2 from Pontellina plumata, also known as ppluGFP2 (Shagin et al., 2004)" CDS 5279..5332 /label=T2A /note="2A peptide from Thosea asigna virus capsid protein" CDS 5333..5929 /label=PuroR /note="puromycin N-acetyltransferase" misc_feature 5933..6520 /label=WPRE /note="woodchuck hepatitis virus posttranscriptional regulatory element" LTR 6594..6827 /label=3' LTR (Delta-U3) /note="self-inactivating 3' long terminal repeat (LTR) from HIV-1" polyA_signal 6899..7033 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin 7039..7174 /label=SV40 ori /note="SV40 origin of replication" primer_bind complement(7212..7228) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(7236..7252) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7260..7290) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(7305..7326) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(7614..8202) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8376..9233) /label=AmpR /note="beta-lactamase" promoter complement(9234..9338) /label=AmpR promoter primer_bind 9812..9828 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"