Basic Vector Information
- Vector Name:
- pENTR-His
- Antibiotic Resistance:
- Kanamycin
- Length:
- 2328 bp
- Type:
- Gene template
- Replication origin:
- ori
- Host:
- E. coli
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pENTR-His vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pENTR-His vector Sequence
LOCUS 62056_9465 2328 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2328) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..2328 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 103..189 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 281..308 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" protein_bind 358..457 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS 467..484 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" protein_bind complement(557..656) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 779..1585 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPGDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1678..2266 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.