Basic Vector Information
- Vector Name:
- pMP2444
- Antibiotic Resistance:
- Gentamycin
- Length:
- 5471 bp
- Type:
- Protein expression
- Replication origin:
- pBBR1 oriV
- Host:
- Broad host
- Promoter:
- lac
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pMP2444 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMP2444 vector Sequence
LOCUS 62056_17225 5471 bp DNA circular SYN 01-JAN-1980 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5471) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..5471 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(264..794) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" promoter complement(983..1011) /label=Pc promoter /note="class 1 integron promoter" protein_bind 1281..1302 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1317..1347 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1355..1371 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1379..1395 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 1416..1434 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind 1464..1480 /label=KS primer /note="common sequencing primer, one of multiple similar variants" CDS 1520..2236 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" promoter complement(2266..2284) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2294..2310) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(3020..3679) /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" rep_origin complement(3680..4449) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.