pCaEXP vector (V013006)

Price Information

Cat No. Plasmid Name Availability Add to cart
V013006 pCaEXP In stock, instant shipping

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Plasmid pCaEXP is designed to allow genes to be placed under the control of the MET3 promoter and to be integrated into the RP10 locus to take advantage of the increased transformation frequency. The regulated gene is cloned into a BamHI site in front of the MET3 promoter. URA3 was used as a model to demonstrate that it can be used to express conditionally a gene with an essential function.

Vector Name:
pCaEXP
Antibiotic Resistance:
Ampicillin
Length:
6293 bp
Type:
Protein expression
Replication origin:
ori
Host:
Hyphal fungi
Source/Author:
R S Care
Promoter:
MET3
Growth Strain(s):
DH10B
Growth Temperature:
37℃

pCaEXP vector Map

pCaEXP6293 bp30060090012001500180021002400270030003300360039004200450048005100540057006000AmpRAmpR promoterRP10M13 fwdMET3 promoterCaURA3M13 revlac operatorlac promoterCAP binding siteori

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Care RS, Trevethick J, Binley KM, Sudbery PE. The MET3 promoter: a new tool for Candida albicans molecular genetics. Mol Microbiol. 1999 Nov;34(4):792-8. doi: 10.1046/j.1365-2958.1999.01641.x. PMID: 10564518.

pCaEXP vector Sequence

LOCUS       Exported                6293 bp DNA     circular SYN 27-NOV-2024
DEFINITION  Exported.
ACCESSION   V013006
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6293)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 6293)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6293
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        complement(693..797)
                     /label=AmpR promoter
     misc_feature    complement(1081..1929)
                     /label=RP10
     primer_bind     2126..2142
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        2144..3481
                     /label=MET3 promoter
                     /note="Candida albicans MET3 promoter"
     misc_feature    3523..4877
                     /label=CaURA3
     CDS             3941..4750
                     /gene="URA3"
                     /label=Orotidine 5'-phosphate decarboxylase
                     /note="Orotidine 5'-phosphate decarboxylase from Candida 
                     albicans (strain SC5314 / ATCC MYA-2876). Accession#: 
                     P13649"
     primer_bind     complement(4898..4914)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4922..4938)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4946..4976)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4991..5012)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5300..5888)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(join(6284..6293,1..692))
                     /codon_start=1
                     /label=AmpR
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIAEGG"