Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012908 | pCHO1.0 | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pCHO1.0
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12988 bp
- Type:
- Protein expression, Antibody expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- MTX,Puro
- Promoter:
- mPGK
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
pCHO1.0 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pCHO1.0 vector Sequence
LOCUS Exported 12988 bp DNA circular SYN 24-OCT-2024 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12988) TITLE Direct Submission REFERENCE 2 (bases 1 to 12988) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..12988 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 125..623 /label=PGK promoter /note="mouse phosphoglycerate kinase 1 promoter" CDS 730..1293 /codon_start=1 /gene="Mus musculus Dhfr" /product="mouse dihydrofolate reductase" /label=DHFR /translation="MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVE GKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQP ELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEY PGVLSEVQEEKGIKYKFEVYEKKD" polyA_signal 1510..1631 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" promoter 1728..5517 /label=EF2/CMV hybrid promoter polyA_signal 5773..6052 /label=CMV poly(A) signal promoter 6093..7565 /label=CMV/EF1 hybrid promoter intron 6608..7546 /label=EF-1-alpha intron A /note="intron upstream of the start codon of human EF-1-alpha" polyA_signal complement(7854..7988) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(8339..8355) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter 8359..8838 /label=hPGK promoter /note="human phosphoglycerate kinase 1 promoter" CDS 8860..9459 /codon_start=1 /gene="pac from Streptomyces alboniger" /product="puromycin N-acetyltransferase" /label=PuroR /note="confers resistance to puromycin" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA" polyA_signal 9689..9823 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(10554..11142) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(11684..12499) /codon_start=1 /gene="aph(3')-Ia" /product="aminoglycoside phosphotransferase" /label=KanR /note="confers resistance to kanamycin in bacteria or G418 (Geneticin(R)) in eukaryotes" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"