Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012839 | pTRKH3-ermGFP | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
Erythromycin, 200 μg/mL. mGFP was under the Enterococcus faecalis ermB promoter.
- Vector Name:
- pTRKH3-ermGFP
- Antibiotic Resistance:
- Erythromycin
- Length:
- 8961 bp
- Type:
- Lactobacillus reuteri Expression Vector
- Replication origin:
- p15A ori
- Source/Author:
- Michela Lizier
- Copy Number:
- Low copy number
- Promoter:
- erythromycin ribosomal methylase promoter
- Growth Strain(s):
- DH5alpha
- Growth Temperature:
- 37℃
pTRKH3-ermGFP vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Lizier M, Sarra PG, Cauda R, Lucchini F. Comparison of expression vectors in Lactobacillus reuteri strains. FEMS Microbiol Lett. 2010 Jul 1;308(1):8-15.
pTRKH3-ermGFP vector Sequence
LOCUS V012839 8961 bp DNA circular SYN 11-MAR-2024 DEFINITION Exported. ACCESSION V012839 VERSION V012839 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8961) AUTHORS . TITLE Direct Submission COMMENT Annotated with pLannotate v1.2.0 FEATURES Location/Qualifiers source 1..8961 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 1509..2243 /gene="ermBP" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Enterococcus faecalis. Accession#: P0A4D5" CDS 3829..5316 /codon_start=1 /label="repS" /note="pLannotate" /note="/database=swissprot" /note="/fragment=False" /note="/identity=97.8" /note="/match_length=100.0" /note="/other=CDS" /translation="MNIPFVVETVLHDGLLKYKFKNSKIRSITTKPGKSKGAIFAYRSK SSMIGGRGVVLTSEEAIQENQDTFTHWTPNVYRYGTYADENRSYTKGHSENNLRQINTF FIDFDIHTAKETISASDILTTAIDLGFMPTMIIKSDKGYQAYFVLETPVYVTSKSEFKS VKAAKIISQNIREYFGKSLPVDLTCNHFGIARIPRTDNVEFFDPNYRYSFKEWQDWSFK QTDNKGFTRSSLTVLSGTEGKKQVDEPWFNLLLHETKFSGEKGLIGRNNVMFTLSLAYF SSGYSIETCEYNMFEFNNRLDQPLEEKEVIKIVRSAYSENYQGANREYITILCKAWVSS DLTSKDLFVRQGWFKFKKKRSERQRVHLSEWKEDLMAYISEKSDVYKPYLVTTKKEIRE VLGIPERTLDKLLKVLKANQEIFFKIKPGRNGGIQLASVKSLLLSIIKVKKEEKESYIK ALTNSFDLEHTFIQETLNKLAERPKTDTQLDLFSYDTG" promoter complement(6029..6131) /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(6657..7202) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 7314..7342 /label="tet promoter" /note="E. coli promoter for tetracycline efflux protein gene" CDS complement(7688..8401) /label="mgfp5" /note="GFP with folding enhancement mutations"