pEF1a-MCS-Neo vector (V012829)

Price Information

Cat No. Plasmid Name Availability Add to cart
V012829 pEF1a-MCS-Neo In stock (lyophilized plasmid)

Buy one, get one free!

Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.

Basic Vector Information

pEF1a-MCS-Neo is a mammalian cell expression vector with EF1a promoter and Neo/G418 selection marker.

      • Vector Name:
      • pEF1a-MCS-Neo
      • Antibiotic Resistance:
      • Kanamycin
      • Length:
      • 4644 bp
      • Type:
      • Mammalian Expression Vectors
      • Selection Marker:
      • Neomycin (select with G418)
      • Copy Number:
      • High copy number
      • Promoter:
      • EF-1α
      • Growth Strain(s):
      • DH5alpha
      • Growth Temperature:
      • 37℃

pEF1a-MCS-Neo vector Vector Map

pEF1a-MCS-Neo4644 bp600120018002400300036004200EF-1-alpha promoterSV40 poly(A) signalf1 oriAmpR promoterSV40 promoterNeoR/KanRHSV TK poly(A) signalori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

References

  • Young TR, Yamamoto M, Kikuchi SS, Yoshida AC, Abe T, Inoue K, Johansen JP, Benucci A, Yoshimura Y, Shimogori T. Thalamocortical control of cell-type specificity drives circuits for processing whisker-related information in mouse barrel cortex. Nat Commun. 2023 Sep 28;14(1):6077.

pEF1a-MCS-Neo vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                4644 bp DNA     circular SYN 16-NOV-2023
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4644)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..4644
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        123..1301
                     /label=EF-1-alpha promoter
                     /note="strong constitutive promoter for human elongation 
                     factor EF-1-alpha"
     intron          354..1292
                     /label=EF-1-alpha intron A
                     /note="intron upstream of the start codon of human 
                     EF-1-alpha"
     polyA_signal    1485..1606
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(1613..2068)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        2095..2199
                     /gene="bla"
                     /label=AmpR promoter
     promoter        2201..2558
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     rep_origin      2409..2544
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     CDS             2593..3387
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    3619..3666
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase 
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      3995..4583
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"