Basic Vector Information
AAV packaging plasmid, expressing Rep2 and Cap5
- Vector Name:
- pAAV2/5
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7371 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Copy Number:
- High copy number
- Promoter:
- P5
- Growth Strain(s):
- NEB Stable
- Growth Temperature:
- 37℃
pAAV2/5 vector Vector Map
pAAV2/5 vector Sequence
LOCUS V012816 7371 bp DNA circular SYN 21-AUG-2023 DEFINITION Exported. ACCESSION V012816 VERSION V012816 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7371) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..7371 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 98..114 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS complement(377..2551) /codon_start=1 /label="capsid protein from AAV5" /translation="MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLV LPGYNYLGPGNGLDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLA DDTSFGGNLGKAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPS TSSDAEAGPSGSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDS TWMGDRVVTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSH WSPRDWQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQ LPYVVGNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTG NNFEFTYNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYA NTYKNWFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQG SNTYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSS TTAPATGTYNLQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL" CDS complement(2571..4430) /gene="Rep78" /label="Protein Rep78" /note="Protein Rep78 from Adeno-associated virus 2 (isolate Srivastava/1982). Accession#: Q89268" protein_bind complement(4593..4640) /label="FRT" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." primer_bind complement(4654..4670) /label="SK primer" /note="common sequencing primer, one of multiple similar variants" primer_bind complement(4720..4736) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4744..4760) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4768..4798) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(4813..4834) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5122..5710) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5884..6741) /label="AmpR" /note="beta-lactamase" promoter complement(6742..6846) /label="AmpR promoter" rep_origin 6873..7328 /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.