Cart 2

pMG36e vector (V012803#)

Basic Vector Information

pMG36e plasmid (pWV01 ori) is based on protease gene transcription and translation signals from Lactococcus lactis cremoris, is a typical artificial constitutive expression vector as a main expression system in Lactococcus.It contains a strong promoter and can express foreign proteins in a variety of bacteria. It has been used to study the action mechanism of bacteriocin, the transformation of lactic acid bacteria genetic engineering strains and the development of oral vaccines. It has been widely used in many fields and has become one of the important tools for lactic acid bacteria genetic engineering research.

Basic Vector Information
Vector Name pMG36e Antibiotic Resistance Erythromycin
Length 3610 bp Type Lactococcus lactis expression plasmid
Copy Number High copy number Promoter P32
Cloning Method Enzyme Cut

pMG36e vector Vector Map

repA Emr P32 ORF

Plasmid Resuspension protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pMG36e vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                3610 bp ds-DNA     circular SYN 17-JUN-2022
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    pMG36e
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3610)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3610
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             227..925
                     /codon_start=1
                     /note="repA"
                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
                     KKDKDTWNSSDVIRNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
                     VLDAETGEIK"
     CDS             complement(1463..2197)
                     /codon_start=1
                     /note="Emr"
                     /translation="MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFT
                     LELVKRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIYGNIPY
                     NISTDIIRKIVFDSIANEIYLIVEYGFAKRLLNTKRSLALLLMAEVDISILSMVPREYF
                     HPKPKVNSSLIRLSRKKSRISHKDKQKYNYFVMKWVNKEYKKIFTKNQFNNSLKHAGID
                     DLNNISFEQFLSLFNSYKLFNK"
     promoter        2474..2652
                     /note="P32"
     CDS             2653..2892
                     /codon_start=1
                     /note="ORF"
                     /translation="MAIVSAEKFVIRARPGIDPLESTCRHASLQSLKTKVAAAVEAAKT
                     VGKGDGTTGTSDKGGGQGTPALRYLELRFKVKWY"

This page is informational only.