Cart 2

pPICZB vector (V012801#)

Price Information

Cat No. Plasmid Name Availability Add to cart
V012801 pPICZB In stock (lyophilized plasmid)

Buy one, get one free!

Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.

Basic Vector Information

Basic Vector Information
Vector Name pPICZB Antibiotic Resistance Zeocin
Length 3328 bp Type Yeast Plasmids
Source Invitrogen Selection Marker Zeocin
Copy Number High copy number Promoter AOX1
Cloning Method Enzyme Cut 5' Primer 5´ AOX1:5´-GACTGGTTCCAATTGACAAGC-3´
3' Primer 3´ AOX1:5´-GCAAATGGCATTCTGACATCC-3´ Fusion Tag C-myc, C-His6
Expression Method Constiutive, Stable / Transient

pPICZB vector Vector Map

pPICZB3328 bp6001200180024003000AOX1 promoterMyc6xHisAOX1 terminatorTEF1 promoterEM7 promoterBleoRCYC1 terminatorori

Plasmid Resuspension protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pPICZB vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                3328 bp ds-DNA     circular SYN 31-MAY-2022
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pPICZB
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3328)
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3328
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        2..940
                     /gene="Pichia pastoris AOX1"
                     /note="AOX1 promoter"
                     /note="inducible promoter, regulated by methanol"
     CDS             1010..1039
                     /codon_start=1
                     /product="Myc (human c-Myc oncogene) epitope tag"
                     /note="Myc"
                     /translation="EQKLISEEDL"
     CDS             1055..1072
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /note="6xHis"
                     /translation="HHHHHH"
     terminator      1152..1398
                     /gene="Pichia pastoris AOX1"
                     /note="AOX1 terminator"
                     /note="transcription terminator for AOX1"
     promoter        1413..1824
                     /gene="S. cerevisiae TEF1"
                     /note="TEF1 promoter"
                     /note="promoter for EF-1-alpha"
     promoter        1832..1879
                     /note="EM7 promoter"
                     /note="synthetic bacterial promoter "
     CDS             1898..2272
                     /codon_start=1
                     /gene="Sh ble from Streptoalloteichus hindustanus"
                     /product="antibiotic-binding protein"
                     /note="BleoR"
                     /note="confers resistance to bleomycin, phleomycin, and 
                     Zeocin(TM)"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     terminator      2338..2585
                     /gene="S. cerevisiae CYC1"
                     /note="CYC1 terminator"
                     /note="transcription terminator for CYC1"
     rep_origin      complement(2660..3248)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"