Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012801 | pPICZB | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
Basic Vector Information | |||
---|---|---|---|
Vector Name | pPICZB | Antibiotic Resistance | Zeocin |
Length | 3328 bp | Type | Yeast Plasmids |
Source | Invitrogen | Selection Marker | Zeocin |
Copy Number | High copy number | Promoter | AOX1 |
Cloning Method | Enzyme Cut | 5' Primer | 5´ AOX1:5´-GACTGGTTCCAATTGACAAGC-3´ |
3' Primer | 3´ AOX1:5´-GCAAATGGCATTCTGACATCC-3´ | Fusion Tag | C-myc, C-His6 |
Expression Method | Constiutive, Stable / Transient |
pPICZB vector Vector Map
Plasmid Resuspension protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPICZB vector Sequence
LOCUS Exported 3328 bp ds-DNA circular SYN 31-MAY-2022 DEFINITION synthetic circular DNA ACCESSION . VERSION . KEYWORDS pPICZB SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3328) TITLE Direct Submission FEATURES Location/Qualifiers source 1..3328 /organism="synthetic DNA construct" /mol_type="other DNA" promoter 2..940 /gene="Pichia pastoris AOX1" /note="AOX1 promoter" /note="inducible promoter, regulated by methanol" CDS 1010..1039 /codon_start=1 /product="Myc (human c-Myc oncogene) epitope tag" /note="Myc" /translation="EQKLISEEDL" CDS 1055..1072 /codon_start=1 /product="6xHis affinity tag" /note="6xHis" /translation="HHHHHH" terminator 1152..1398 /gene="Pichia pastoris AOX1" /note="AOX1 terminator" /note="transcription terminator for AOX1" promoter 1413..1824 /gene="S. cerevisiae TEF1" /note="TEF1 promoter" /note="promoter for EF-1-alpha" promoter 1832..1879 /note="EM7 promoter" /note="synthetic bacterial promoter " CDS 1898..2272 /codon_start=1 /gene="Sh ble from Streptoalloteichus hindustanus" /product="antibiotic-binding protein" /note="BleoR" /note="confers resistance to bleomycin, phleomycin, and Zeocin(TM)" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" terminator 2338..2585 /gene="S. cerevisiae CYC1" /note="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(2660..3248) /direction=LEFT /note="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"