Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012789 | pMDLg/pRRE | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
3rd generation lentiviral packaging plasmid; Contains Gag and Pol; also requires pRSV-Rev and envelope expressing plasmid
- Vector Name:
- pMDLg/pRRE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8895 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Source/Author:
- Dr. Didier Trono's lab
- Copy Number:
- High copy number
- Promoter:
- CMV+intron
- Growth Strain(s):
- Stable
- Growth Temperature:
- 37℃
- Expression Method:
- Constiutive, Stable
pMDLg/pRRE vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMDLg/pRRE vector Sequence
LOCUS pMDLg-pRRE.gb. 8895 bp DNA circular SYN 13-DEC-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS pMDLg-pRRE.gb SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8895) TITLE Direct Submission REFERENCE 2 (bases 1 to 8895) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..8895 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 161..540 /note="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" promoter 541..744 /note="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" intron 878..1353 /label=beta-globin intron /note="internally truncated intron from human beta-globin" CDS 1437..2945 /codon_start=1 /label=HIV-1 gag /note="HIV-1 gag" /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFA VNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKI EEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKA FSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGP IAPGQMREPRGSDIAGTTSTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSP TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALG PGATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGK EGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPT APPEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ" CDS 2738..5746 /label=HIV-1 pol /note="pol protein from human immunodeficiency virus 1" misc_feature 5774..6007 /label=RRE /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." polyA_signal 6238..6631 /label=beta-globin poly(A) /note="human beta-globin polyadenylation signal" rep_origin complement(7141..7729) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7903..8760) /label=AmpR /note="beta-lactamase" promoter complement(8761..8865) /label=AmpR promoter