Cart 2

pacAd5 CMVK-NpA vector (V012788#)

Basic Vector Information

pacAd5 K-NpA shuttle vector does not contain a promoter ahead of the multiple cloning sites. You must clone a promoter into the vector along with your gene of interest.

Basic Vector Information
Vector Name pacAd5 CMVK-NpA Antibiotic Resistance Ampicillin
Length 6215 bp Type Adenoviral Expression Vector
Source Cell BioLabs Copy Number High copy number
Promoter CMV Cloning Method Enzyme Cut

pacAd5 CMVK-NpA vector Vector Map

ITR Ad5 Psi CMV enhancer CMV promoter KS primer SK primer SV40 poly(A) signal 3328-5792 of Ad5 ori bla bla

pacAd5 CMVK-NpA vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6215 bp ds-DNA     circular SYN 17-NOV-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6215)
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6215
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     repeat_region   16..118
                     /note="ITR"
                     /note="inverted terminal repeat of human adenovirus 
                     serotype 5"
     misc_signal     206..356
                     /note="Ad5 Psi"
                     /note="packaging signal for adenovirus serotype 5"
     enhancer        385..688
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        689..892
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     primer_bind     928..944
                     /note="KS primer"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(978..994)
                     /note="SK primer"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     polyA_signal    1014..1148
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     misc_feature    1441..3895
                     /note="3328-5792 of Ad5"
     rep_origin      complement(4388..4976)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5147..6007)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="[TEM beta-lactamase fragment, 45 aa]
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     [TEM beta-lactamase fragment, 59 aa]
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     [TEM beta-lactamase fragment, 59 aa]
                     LIKHW"
     promoter        complement(6008..6112)
                     /gene="bla"
                     /note="AmpR promoter"

This page is informational only.