Cart 2

pacAd5 CMV-GFP vector (V012787#)

Basic Vector Information

Basic Vector Information
Vector Name pacAd5 CMV-GFP Antibiotic Resistance Ampicillin
Length 6935 bp Type Adenoviral Expression Vector
Source Cell BioLabs Copy Number High copy number
Promoter CMV Cloning Method Enzyme Cut
Fusion Tag EGFP

pacAd5 CMV-GFP vector Vector Map

ITR Ad5 Psi CMV enhancer CMV promoter MCS EGFP SV40 poly(A) signal 3328-5792 of Ad5 ori bla bla

pacAd5 CMV-GFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6935 bp ds-DNA     circular SYN 17-NOV-2021
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pacAd5 CMV-GFP
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6935)
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6935
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     repeat_region   16..118
                     /note="ITR"
                     /note="inverted terminal repeat of human adenovirus 
                     serotype 5"
     misc_signal     206..356
                     /note="Ad5 Psi"
                     /note="packaging signal for adenovirus serotype 5"
     enhancer        385..688
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        689..892
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     misc_feature    926..978
                     /note="MCS"
                     /note="multiple cloning site"
     CDS             992..1711
                     /codon_start=1
                     /product="enhanced GFP"
                     /note="EGFP"
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     polyA_signal    1732..1866
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     misc_feature    2161..4615
                     /note="3328-5792 of Ad5"
     rep_origin      complement(5108..5696)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5867..6727)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(6728..6832)
                     /gene="bla"
                     /note="AmpR promoter"

This page is informational only.