Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012782 | pBAD33 | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
pBAD33 is a low copy number expression vector regulated by the arabinose operon.
- Vector Name:
- pBAD33
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5352 bp
- Type:
- E.coli expression plasmid
- Replication origin:
- p15A ori
- Source/Author:
- Beckwith Lab
- Copy Number:
- Low copy number
- Promoter:
- araBAD
- Cloning Method:
- Enzyme Cut
- 5' Primer:
- pBAD-F: ATGCCATAGCATTTTTATCC
- 3' Primer:
- pBAD-R: gatttaatctgtatcagg
- Expression Method:
- L-arabinose Induced
pBAD33 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
References
- Lau TV, Puah SM, Tan JMA, Merino S, Puthucheary SD, Chua KH. Flagellar motility mediates biofilm formation in Aeromonas dhakensis. Microb Pathog. 2023 Apr;177:106059.
pBAD33 vector Sequence
LOCUS 40924_5864 5352 bp DNA circular SYN 22-SEP-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5352) TITLE Direct Submission REFERENCE 2 (bases 1 to 5352) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..5352 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(99..974) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 1001..1285 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" misc_feature 1306..1362 /label=MCS /note="pUC18/19 multiple cloning site" terminator 1565..1651 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1743..1770 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 1789..1880 /label=AmpR promoter rep_origin 2334..2789 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(3347..4003) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(4004..4106) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(4632..5177) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin."