Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012767 | pVitro2-neo-mcs | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
Expression plasmids pVITRO2-MCS are developed mainly for in vitro studies. pVITRO2-MCS allows the ubiquitous and constitutive co-expression of two genes of interest. pVITRO2-MCS plasmids carry two human ferritin composite promoters, FerH (heavy chain) and FerL (light chain). To eliminate the iron regulation, their 5’UTRs have been replaced by the 5’UTR of the mouse and chimpanzee EF-1α genes. pVITRO2-MCS plasmids are available with different selectable markers that are active both in E. coli and mammalian cells. pVITRO2-MCS plasmids contain two multiple cloning sites (MCS) for the convenient cloning of your cDNAs of interest.
- Vector Name:
- pVitro2-neo-mcs
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6125 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Invivogen
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
- Cloning Method:
- Enzyme Cut
- 5' Primer:
- EF-1a-F:TCAAGCCTCAGACAGTGGTTC
- Expression Method:
- Constiutive, Stable / Transient
pVitro2-neo-mcs vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pVitro2-neo-mcs vector Sequence
LOCUS 40924_45993 6125 bp DNA circular SYN 18-SEP-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6125) TITLE Direct Submission REFERENCE 2 (bases 1 to 6125) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..6125 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 9..312 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" intron 700..1644 /label=EF-1-alpha intron A /note="intron upstream of the start codon of human EF-1-alpha" polyA_signal complement(1728..1849) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin 2037..2625 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" enhancer 2747..2938 /label=SV40 enhancer /note="enhancer for the SV40 early promoter (Herr, 1993)" intron 3145..4092 /label=mEF-1-alpha intron /note="intron upstream of the start codon of mouse EF-1-alpha" misc_feature 4167..4611 /label=FMDV IRES /note="internal ribosome entry site (IRES) of the foot-and-mouth disease virus" promoter 4644..4691 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 4711..5502 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 5552..6124 /label=EF-1-alpha poly(A) signal /note="human EF-1-alpha polyadenylation signal"