Basic Vector Information
Expression plasmids pVITRO2-MCS are developed mainly for in vitro studies. pVITRO2-MCS allows the ubiquitous and constitutive co-expression of two genes of interest. pVITRO2-MCS plasmids carry two human ferritin composite promoters, FerH (heavy chain) and FerL (light chain). To eliminate the iron regulation, their 5’UTRs have been replaced by the 5’UTR of the mouse and chimpanzee EF-1α genes. pVITRO2-MCS plasmids are available with different selectable markers that are active both in E. coli and mammalian cells. pVITRO2-MCS plasmids contain two multiple cloning sites (MCS) for the convenient cloning of your cDNAs of interest.
- Vector Name:
- pVitro2-neo-mcs
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6125 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Invivogen
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
- Cloning Method:
- Enzyme Cut
- 5' Primer:
- EF-1a-F:TCAAGCCTCAGACAGTGGTTC
- Expression Method:
- Constiutive, Stable / Transient
pVitro2-neo-mcs vector Vector Map
pVitro2-neo-mcs vector Sequence
LOCUS 40924_45993 6125 bp DNA circular SYN 18-SEP-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6125) TITLE Direct Submission REFERENCE 2 (bases 1 to 6125) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..6125 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 9..312 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" intron 700..1644 /label=EF-1-alpha intron A /note="intron upstream of the start codon of human EF-1-alpha" polyA_signal complement(1728..1849) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin 2037..2625 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" enhancer 2747..2938 /label=SV40 enhancer /note="enhancer for the SV40 early promoter (Herr, 1993)" intron 3145..4092 /label=mEF-1-alpha intron /note="intron upstream of the start codon of mouse EF-1-alpha" misc_feature 4167..4611 /label=FMDV IRES /note="internal ribosome entry site (IRES) of the foot-and-mouth disease virus" promoter 4644..4691 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 4711..5502 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 5552..6124 /label=EF-1-alpha poly(A) signal /note="human EF-1-alpha polyadenylation signal"
This page is informational only.