Basic Vector Information
Tightly regulated tac promoter vectors useful for the expression of unfused and fused proteins in Escherichia coli
Basic Vector Information | |||
---|---|---|---|
Vector Name | pTrc99a | Antibiotic Resistance | Ampicillin |
Length | 4176 bp | Type | Bacterial expression vector |
Copy Number | High copy number | Promoter | trc |
Cloning Method | Enzyme Cut | 5' Primer | GAGCGGATAACAATTTCACACAGG |
3' Primer | GATTTAATCTGTATCAGG | Expression Method | IPTG induced |
pTrc99a vector Vector Map
pTrc99a vector Sequence
LOCUS Exported 4176 bp ds-DNA circular SYN 09-DEC-2020 DEFINITION synthetic circular DNA ACCESSION . VERSION . KEYWORDS pTrc99a SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4176) AUTHORS caoheibi TITLE Direct Submission JOURNAL Exported Wednesday, December 9, 2020 from SnapGene 3.2.1 http://www.snapgene.com FEATURES Location/Qualifiers source 1..4176 /organism="synthetic DNA construct" /mol_type="other DNA" misc_feature 193..222 /note="trc promoter" /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 230..246 /bound_moiety="lac repressor encoded by lacI" /note="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature 270..326 /note="MCS" /note="pUC18/19 multiple cloning site" terminator 529..615 /gene="Escherichia coli rrnB" /note="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 707..734 /note="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" promoter 754..845 /gene="bla" /note="AmpR promoter" CDS 846..1706 /codon_start=1 /gene="bla" /product="beta-lactamase" /note="AmpR" /note="confers resistance to ampicillin, carbenicillin, and related antibiotics" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPTAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 1877..2465 /direction=RIGHT /note="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 2651..2791 /note="bom" /note="basis of mobility region from pBR322" promoter 2977..3054 /gene="lacI (mutant)" /note="lacIq promoter" /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 3055..4137 /codon_start=1 /gene="lacI" /product="lac repressor" /note="lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ"
This page is informational only.