Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V000169 | GST-HA-GFP11-N1 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- GST-HA-GFP11-N1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4759 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Selection Marker:
- Kan/Neo
- Copy Number:
- High Copy
- Promoter:
- CMV
- Cloning Method:
- Restriction Enzyme
GST-HA-GFP11-N1 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
GST-HA-GFP11-N1 vector Sequence
LOCUS 40924_1239 4759 bp DNA circular SYN 13-MAY-2021 DEFINITION Expresses GST-HA-GFP11 in mammalian cells. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4759) AUTHORS Ruan L, Zhou C, Jin E, Kucharavy A, Zhang Y, Wen Z, Florens L, Li R TITLE Cytosolic proteostasis through importing of misfolded proteins into mitochondria. JOURNAL Nature. 2017 Mar 16;543(7645):443-446. doi: 10.1038/nature21695. Epub 2017 Mar 1. PUBMED 28241148 REFERENCE 2 (bases 1 to 4759) TITLE Direct Submission REFERENCE 3 (bases 1 to 4759) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; doi: "10.1038/nature21695"; journalName: "Nature"; date: "2017-03-16- 16"; volume: "543"; issue: "7645"; pages: "443-446" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4759 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 124..427 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 428..631 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 691..1344 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 1372..1398 /codon_start=1 /label=HA /note="HA (human influenza hemagglutinin) epitope tag" /translation="YPYDVPDYA" CDS 1438..1485 /codon_start=1 /label=GFP11 /note="11th beta-strand of superfolder GFP" /translation="RDHMVLHEYVNAAGIT" polyA_signal 1610..1731 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1738..2193) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2220..2324 /label=AmpR promoter promoter 2326..2683 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2718..3509 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" primer_bind complement(3700..3719) /label=TK-pA-R /note="Thymidine kinase polyA, reverse primer" polyA_signal 3744..3791 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4120..4708 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"