Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V000024 | 5'UTR CGG 99x FMR1-EGFP | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
Low Ampicillin
- Vector Name:
- 5'UTR CGG 99x FMR1-EGFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4688 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Promoter:
- CMV
- 5' Primer:
- CMV-F
5'UTR CGG 99x FMR1-EGFP vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
5'UTR CGG 99x FMR1-EGFP vector Sequence
LOCUS 40924_95 4688 bp DNA circular SYN 13-MAY-2021 DEFINITION Contains expanded CGG repeats (99 repeats) within the 5'UTR of FMR1 as found in the Fragile X Tremor Ataxia Syndrome (FXTAS). These repeats are in frame with EGFP.. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4688) TITLE Charlet-Berguerand plasmids JOURNAL Unpublished REFERENCE 2 (bases 1 to 4688) TITLE Direct Submission REFERENCE 3 (bases 1 to 4688) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4688 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(1..105) /label=AmpR promoter primer_bind 173..191 /label=pBRforEco /note="pBR322 vectors, upsteam of EcoRI site, forward primer" enhancer 356..734 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 735..938 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 983..1001 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 1625..2338 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITLGMDELYK" polyA_signal complement(2372..2493) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(2637..2659) /label=pGEX 3' /note="pGEX vectors, reverse primer" misc_feature 2743..2883 /label=bom /note="basis of mobility region from pBR322" primer_bind complement(2898..2915) /label=L4440 /note="L4440 vector, forward primer" rep_origin complement(3069..3657) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3831..4688) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW"