pCE-hUL vector (V000584)

Price Information

Cat No. Plasmid Name Availability Add to cart
V000584 pCE-hUL In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pCE-hUL
Antibiotic Resistance:
Ampicillin
Length:
11232 bp
Type:
Mammalian Expression
Replication origin:
ori
Copy Number:
High Copy
Promoter:
CAG
Cloning Method:
Restriction Enzyme
5' Primer:
pCAG-F
3' Primer:
TTAGCCAGAAGTCAGATGCTC

pCE-hUL vector Map

pCE-hUL11232 bp500100015002000250030003500400045005000550060006500700075008000850090009500100001050011000Bglob-pA-Rbeta-globin poly(A) signalM13 revlac operatorlac promoterCAP binding siteEBNA1oriPL4440oriAmpRAmpR promoterCMV enhancerchicken beta-actin promoterchimeric intronpCAG-FProtein L-MycF2AhLIN28A

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pCE-hUL vector Sequence

LOCUS       V000584                11232 bp    DNA     circular SYN 10-JUN-2021
DEFINITION  Exported.
ACCESSION   V000584
VERSION     V000584
KEYWORDS    pCE-hUL
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 11232)
  AUTHORS   Okita K, Yamakawa T, Matsumura Y, Sato Y, Amano N, Watanabe A,
            Goshima N, Yamanaka S
  TITLE     An Efficient Non-viral Method to Generate Integration-Free Human iPS
            Cells from Cord Blood and Peripheral Blood Cells.
  JOURNAL   Stem Cells. 2012 Nov 29. doi: 10.1002/stem.1293.
   PUBMED   23193063
REFERENCE   2  (bases 1 to 11232)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 11232)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Stem Cells.
            2012 Nov 29. doi: 10.1002/stem.1293."
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11232
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     complement(83..102)
                     /label="Bglob-pA-R"
                     /note="Rabbit beta-globin polyA region, reverse primer"
     polyA_signal    148..203
                     /label="beta-globin poly(A) signal"
                     /note="rabbit beta-globin polyadenylation signal (Gil and
                     Proudfoot, 1987)"
     primer_bind     complement(202..221)
                     /label="rbglobpA-R"
                     /note="Rabbit beta-globin polyA, reverse primer. Also
                     called rb-glob-pA-term-R"
     primer_bind     complement(564..580)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(588..604)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(612..642)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(657..678)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     CDS             1157..3079
                     /codon_start=1
                     /product="Epstein-Barr nuclear antigen 1, also known as
                     EBNA-1"
                     /label="EBNA1"
                     /note="crucial for latent viral infection, and for episomal
                     amplification of vectors containing the oriP origin (Okita
                     et al., 2013)"
                     /translation="MSDEGPGTGPGNGLGEKGDTSGPEGSGGSGPQRRGGDNHGRGRGR
                     GRGRGGGRPGAPGGSGSGPRHRDGVRRPQKRPSCIGCKGTHGGTGAGAGAGGAGAGGAG
                     AGGGAGAGGGAGGAGGAGGAGAGGGAGXGGGAGGAGGAGAGGGAGXGGGAGGAGAGGGA
                     GGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGG
                     GAGGAGGAGAGGAGAGGAGAGGAGAGGAGGAGAGGAGGAGAGGAGGXGAGGAGGAGAGG
                     GAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGGGRGRGGSGGRGRGG
                     SGGRGRGGSGGRRGRGRERARGGSRERARGRGRGRGEKRPRSPSSQSSSSGSPPRRPPP
                     GRRPFFHPVGEADYFEYHQEGGPDGEPDVPPGAIEQGPADDPGEGPSTGPRGQGDGGRR
                     KKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLY
                     NLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKD
                     AIKDLVMTKPAPTCNIRVTVCSFDDGVDLPPWFPPMVEGAAAEGDDGDDGDEGGDGDEG
                     EEGQE"
     rep_origin      3381..5170
                     /label="oriP"
                     /note="Epstein-Barr virus oriP replication origin (Yates et
                     al., 2000)"
     primer_bind     complement(5711..5728)
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     rep_origin      complement(5882..6470)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(6644..7501)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(7502..7606)
                     /label="AmpR promoter"
     enhancer        7637..8016
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        8018..8295
                     /label="chicken beta-actin promoter"
     intron          8296..9312
                     /label="chimeric intron"
                     /note="chimera between introns from chicken beta-actin and
                     rabbit beta-globin"
     primer_bind     9320..9339
                     /label="pCAG-F"
                     /note="Rabbit beta-globin intron, for pCAG plasmids,
                     forward primer"
     CDS             9377..10468
                     /gene="MYCL"
                     /label="Protein L-Myc"
                     /note="Protein L-Myc from Homo sapiens. Accession#: P12524"
     CDS             10493..10558
                     /label="F2A"
                     /note="2A peptide from foot-and-mouth disease virus
                     polyprotein"
     CDS             10583..11209
                     /label="hLIN28A"
                     /note="Human lin-28 homolog A gene. Encodes a LIN-28 family
                     RNA-binding protein that acts as a posttranscriptional
                     regulator of genes involved in development, self-renewal of
                     embryonic stem cells and metabolism. Overexpressed in human
                     embryonic stem cells, primary human tumors and human cancer
                     cell lines."