pLB2 CAG P2Gm vector (V000590)

Price Information

Cat No. Plasmid Name Availability Add to cart
V000590 pLB2 CAG P2Gm In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pLB2 CAG P2Gm
Antibiotic Resistance:
Ampicillin
Length:
10656 bp
Type:
Mammalian Expression, Mouse Targeting, Lentiviral,
Replication origin:
ori
Selection Marker:
Puromycin
Copy Number:
Low Copy
Promoter:
CAG
Cloning Method:
Restriction Enzyme
5' Primer:
GFP miR primer (GCTGGAGTTCGTGACCGCC)

pLB2 CAG P2Gm vector Map

pLB2 CAG P2Gm10656 bp5001000150020002500300035004000450050005500600065007000750080008500900095001000010500pRS-markerL4440CAP binding sitelac promoterIn lacZ geneRSV promoter5' LTR (truncated)HIV-1 PsiRREgp41 peptideProtein TatcPPT/CTSCMV enhancerchicken beta-actin promoterchimeric intronpCAG-FPuroRF2AEGFP5' miR-30amiR-30a loop3' miR-30aWPREpBluescriptKSbGH poly(A) signal5' LTR (truncated)oriAmpRAmpR promoter

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pLB2 CAG P2Gm vector Sequence

LOCUS       V000590                10656 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V000590
VERSION     V000590
KEYWORDS    pLB2 CAG P2Gm
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 10656)
  AUTHORS   Stern P, Astrof S, Erkeland SJ, Schustak J, Sharp PA, Hynes RO
  TITLE     A system for Cre-regulated RNA interference in vivo.
  JOURNAL   Proc Natl Acad Sci U S A. 2008 Sep 16. 105(37):13895-900.
   PUBMED   18779577
REFERENCE   2  (bases 1 to 10656)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 10656)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc Natl
            Acad Sci U S A. 2008 Sep 16. 105(37):13895-900."
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10656
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     complement(47..66)
                     /label="pRS-marker"
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"
     primer_bind     355..372
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     protein_bind    489..510
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        525..555
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    563..579
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     568..590
                     /label="M13/pUC Reverse"
                     /note="In lacZ gene"
     primer_bind     587..603
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     587..603
                     /label="M13 Reverse"
                     /note="In lacZ gene. Also called M13-rev"
     promoter        641..868
                     /label="RSV promoter"
                     /note="Rous sarcoma virus enhancer/promoter"
     LTR             869..1049
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    1096..1221
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    1720..1953
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             2138..2182
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             2331..2372
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    2480..2597
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     enhancer        3119..3422
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        3424..3701
                     /label="chicken beta-actin promoter"
     intron          3703..4720
                     /label="chimeric intron"
                     /note="chimera between introns from chicken beta-actin and
                     rabbit beta-globin"
     primer_bind     4728..4747
                     /label="pCAG-F"
                     /note="Rabbit beta-globin intron, for pCAG plasmids,
                     forward primer"
     regulatory      4809..4818
                     /label="Kozak sequence"
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             4815..5411
                     /codon_start=1
                     /gene="pac from Streptomyces alboniger"
                     /product="puromycin N-acetyltransferase"
                     /label="PuroR"
                     /note="confers resistance to puromycin"
                     /translation="MVEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
     primer_bind     5311..5331
                     /label="Puro-F"
                     /note="Puromycin resistance gene, forward primer"
     CDS             5433..5498
                     /codon_start=1
                     /product="2A peptide from foot-and-mouth disease virus
                     polyprotein"
                     /label="F2A"
                     /note="Eukaryotic ribosomes fail to insert a peptide bond
                     between the Gly and Pro residues, yielding separate
                     polypeptides."
                     /translation="VKQTLNFDLLKLAGDVESNPGP"
     CDS             5514..6230
                     /label="EGFP"
                     /note="enhanced GFP"
     ncRNA           6283..6404
                     /label="5' miR-30a"
                     /note="sequence upstream of the 71-nt precursor of the
                     human miR-30a microRNA (Zeng et al., 2002)"
     ncRNA           6431..6445
                     /label="miR-30a loop"
                     /note="loop from the the 71-nt precursor of the human
                     miR-30a microRNA (Zeng et al., 2002)"
                     /ncRNA_class="miRNA"
     ncRNA           6473..6599
                     /label="3' miR-30a"
                     /note="sequence downstream of the 71-nt precursor of the
                     human miR-30a microRNA (Zeng et al., 2002)"
     misc_feature    6685..7273
                     /label="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     primer_bind     complement(7276..7292)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(7277..7293)
                     /label="pBluescriptKS"
                     /note="For pBluescript vector"
     polyA_signal    8436..8643
                     /label="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     LTR             8662..8842
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     rep_origin      complement(8904..9492)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(9666..10523)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(10524..10628)
                     /label="AmpR promoter"