Basic Vector Information
- Vector Name:
- pENTR1A-Huwe1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 16589 bp
- Type:
- Gateway Entry
- Replication origin:
- ori
- Copy Number:
- Low Copy
- Cloning Method:
- Gateway Cloning
- 5' Primer:
- hHuwe1-R GCCAAATGTTGTAGCCGAGT)(
- 3' Primer:
- hHuwe1-F (TATCAGGACTGCCCACCATT)
pENTR1A-Huwe1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pENTR1A-Huwe1 vector Sequence
LOCUS 40924_17483 16589 bp DNA circular SYN 13-MAY-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 16589) AUTHORS Cook, Jean TITLE Huwe1 plasmids JOURNAL Unpublished REFERENCE 2 (bases 1 to 16589) TITLE Direct Submission REFERENCE 3 (bases 1 to 16589) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..16589 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 1..100 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" protein_bind complement(14461..14560) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 14683..15489 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVSLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 15582..16170 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator 16335..16421 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 16513..16540 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" primer_bind 16548..16571 /label=pENTR-F /note="pENTR vectors, forward primer"
This page is informational only.