Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V000947 | pGreenIIM DR5v2-ntdTomato/DR5-n3GFP | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pGreenIIM DR5v2-ntdTomato/DR5-n3GFP
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9680 bp
- Type:
- Plant Expression
- Replication origin:
- pSa ori
- Host:
- Plants
- Selection Marker:
- Methothrexate
- Copy Number:
- Low Copy
- Promoter:
- CaMV 35S
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- dsRed1_C_primer
- Growth Strain(s):
- stbl3
- Growth Temperature:
- 37℃
pGreenIIM DR5v2-ntdTomato/DR5-n3GFP vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pGreenIIM DR5v2-ntdTomato/DR5-n3GFP vector Sequence
LOCUS 40924_22622 9680 bp DNA circular SYN 13-MAY-2021 DEFINITION Expresses nuclear tdTomato from auxin-dependent DR5v2 (TGTCGG) promoter and nuclear 3xGFP from the DR5 (TGTCTC) promoter. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9680) AUTHORS Liao CY, Smet W, Brunoud G, Yoshida S, Vernoux T, Weijers D TITLE Reporters for sensitive and quantitative measurement of auxin response. JOURNAL Nat Methods. 2015 Mar;12(3):207-10. doi: 10.1038/nmeth.3279. Epub 2015 Feb 2. PUBMED 25643149 REFERENCE 2 (bases 1 to 9680) TITLE Direct Submission REFERENCE 3 (bases 1 to 9680) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; doi: "10.1038/nmeth.3279"; journalName: "Nat Methods"; date: "2015-03"; volume: "12"; issue: "3"; pages: "207-10" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..9680 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 157..202 /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" misc_feature 213..268 /label=TMV Omega /note="translational enhancer from the tobacco mosaic virus 5'-leader sequence (Gallie et al., 1988)" CDS 315..335 /codon_start=1 /product="nuclear localization signal of SV40 (simian virus 40) large T antigen" /label=SV40 NLS /translation="PKKKRKV" CDS 336..1763 /codon_start=1 /label=tdTomato /note="tandem dimeric (pseudo-monomeric) derivative of DsRed (Shaner et al., 2004)" /translation="MVSKGEEVIKEFMRFKVRMEGSMNGHEFEIEGEGEGRPYEGTQTA KLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYKKLSFPEGFKWERVMNFEDGG LVTVTQDSSLQDGTLIYKVKMRGTNFPPDGPVMQKKTMGWEASTERLYPRDGVLKGEIH QALKLKDGGHYLVEFKTIYMAKKPVQLPGYYYVDTKLDITSHNEDYTIVEQYERSEGRH HLFLGHGTGSTGSGSSGTASSEDNNMAVIKEFMRFKVRMEGSMNGHEFEIEGEGEGRPY EGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYKKLSFPEGFKWERVM NFEDGGLVTVTQDSSLQDGTLIYKVKMRGTNFPPDGPVMQKKTMGWEASTERLYPRDGV LKGEIHQALKLKDGGHYLVEFKTIYMAKKPVQLPGYYYVDTKLDITSHNEDYTIVEQYE RSEGRHHLFLYGMDELYK" promoter 2192..2237 /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" misc_feature 2248..2303 /label=TMV Omega /note="translational enhancer from the tobacco mosaic virus 5'-leader sequence (Gallie et al., 1988)" CDS 2325..2345 /codon_start=1 /product="nuclear localization signal of SV40 (simian virus 40) large T antigen" /label=SV40 NLS /translation="PKKKRKV" CDS 2346..3062 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" CDS 3069..3788 /codon_start=1 /product="the original enhanced GFP (Yang et al., 1996)" /label=EGFP /note="mammalian codon-optimized" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" CDS 3069..3785 /codon_start=1 /product="enhanced GFP" /label=EGFP /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" CDS 3809..4516 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MSSKGEELFTGVVPILVELDGDGNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITHGMDE" promoter complement(4869..4887) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(4908..4924) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4932..4948) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4956..4986) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(5001..5022) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." primer_bind complement(5139..5156) /label=L4440 /note="L4440 vector, forward primer" misc_feature 5261..5285 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" rep_origin complement(5376..5964) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6138..6950) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 7241..7676 /label=pSa ori /note="origin of replication from bacterial plasmid pSa" misc_feature 7803..7825 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" polyA_signal 7833..8009 /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" CDS complement(8408..8968) /codon_start=1 /label=DHFR /note="mouse dihydrofolate reductase" /translation="MVRPLNCIVAVSQNMGIGKNGDRPWPPLRNEFKYFQRMTTTSSVE GKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQP ELASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEY PGVLSEVQEEKGIKYKFEVYEKKD" promoter complement(9001..9346) /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" primer_bind 9564..9580 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 9590..9608 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase"