lenti-EF1a-dCas9-VPR-Puro vector (V000970)

Price Information

Cat No. Plasmid Name Availability Add to cart
V000970 lenti-EF1a-dCas9-VPR-Puro In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
lenti-EF1a-dCas9-VPR-Puro
Antibiotic Resistance:
Ampicillin
Length:
15702 bp
Type:
Mammalian Expression, Lentiviral, CRISPR
Replication origin:
ori
Selection Marker:
Puromycin, Zeocin
Copy Number:
High Copy
Promoter:
EF-1α
Cloning Method:
Gibson Cloning
5' Primer:
GTTTGGATCTTGGTTCATTCTCAAGCCTCAG
3' Primer:
cacatagcgtaaaaggagcaacatag

lenti-EF1a-dCas9-VPR-Puro vector Vector Map

lenti-EF1a-dCas9-VPR-Puro15702 bp70014002100280035004200490056006300700077008400910098001050011200119001260013300140001470015400EF-1-alpha promoterCas9m4SV40 NLSattB1VP64SV40 NLSRelA (p65) ADRta ADP2APuroRWPREKS primer5' LTR (truncated)bGH poly(A) signalf1 oripBABE 3'SV40 promoterEM7 promoterBleoRSV40 poly(A) signalM13 revlac operatorlac promoterCAP binding siteL4440oriAmpRAmpR promoterpRS-markerCMV enhancerCMV promoter5' LTR (truncated)HIV-1 PsiRREgp41 peptideProtein TatcPPT/CTS

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

lenti-EF1a-dCas9-VPR-Puro vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V000970                15702 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V000970
VERSION     V000970
KEYWORDS    lenti-EF1a-dCas9-VPR-Puro
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 15702)
  AUTHORS   Ho SM, Hartley BJ, Flaherty E, Rajarajan P, Abdelaal R, Obiorah I,
            Barretto N, Muhammad H, Phatnani HP, Akbarian S, Brennand KJ
  TITLE     Evaluating Synthetic Activation and Repression of
            Neuropsychiatric-Related Genes in hiPSC-Derived NPCs, Neurons, and
            Astrocytes.
  JOURNAL   Stem Cell Reports. 2017 Aug 8;9(2):615-628. doi:
            10.1016/j.stemcr.2017.06.012. Epub 2017 Jul 27.
   PUBMED   28757163
REFERENCE   2  (bases 1 to 15702)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 15702)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; doi:
            "10.1016/j.stemcr.2017.06.012"; journalName: "Stem Cell Reports";
            date: "2017-08-8- 8"; volume: "9"; issue: "2"; pages: "615-628"
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..15702
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        130..1308
                     /label="EF-1-alpha promoter"
                     /note="strong constitutive promoter for human elongation
                     factor EF-1-alpha"
     CDS             1339..5442
                     /label="Cas9m4"
                     /note="catalytically dead mutant of the Cas9 endonuclease
                     from the Streptococcus pyogenes Type II CRISPR/Cas system"
     CDS             5455..5475
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label="SV40 NLS"
                     /translation="PKKKRKV"
     protein_bind    5512..5536
                     /gene="mutant version of attB"
                     /label="attB1"
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"
     CDS             5566..5715
                     /codon_start=1
                     /product="tetrameric repeat of the minimal activation
                     domain of herpes simplex virus VP16 (Beerli et al., 1998)"
                     /label="VP64"
                     /translation="DALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDF
                     DLDML"
     CDS             5740..5760
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label="SV40 NLS"
                     /translation="PKKKRKV"
     CDS             6190..6546
                     /codon_start=1
                     /product="transcriptional activation domain of human RelA,
                     also known as p65 (O'Shea and Perkins, 2008)"
                     /label="RelA (p65) AD"
                     /translation="PTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNS
                     EFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGD
                     EDFSSIADMDFSALL"
     CDS             6565..7134
                     /codon_start=1
                     /product="transcriptional activation domain from the human
                     herpesvirus 4 (Epstein-Barr virus) replication and
                     transcription activator Rta/BRLF1 (Hardwick et al., 1992;
                     Chavez et al., 2015)"
                     /label="Rta AD"
                     /translation="RDSREGMFLPKPEAGSAISDVFEGREVCQPKRIRPFHPPGSPWAN
                     RPLPASLAPTPTGPVHEPVGSLTPAPVPQPLDPAPAVTPEASHLLEDPDEETSQAVKAL
                     REMADTVIPQKEEAAICGQMDLSHPPPRGHLDELTTTLESMTEDLNLDSPLTPELNEIL
                     DTFLNDECLLHAMHISTGLSIFDTSLF"
     CDS             7150..7206
                     /label="P2A"
                     /note="2A peptide from porcine teschovirus-1 polyprotein"
     CDS             7219..7809
                     /label="PuroR"
                     /note="puromycin N-acetyltransferase"
     misc_feature    7837..8425
                     /label="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     primer_bind     complement(8428..8444)
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(8429..8445)
                     /label="pBluescriptKS"
                     /note="For pBluescript vector"
     LTR             8950..9130
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     polyA_signal    9162..9386
                     /label="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      9432..9860
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     complement(9869..9889)
                     /label="pBABE 3'"
                     /note="SV40 enhancer, reverse primer for pBABE vectors"
     promoter        10007..10203
                     /label="SV40 promoter"
                     /note="SV40 early promoter"
     promoter        10251..10298
                     /label="EM7 promoter"
                     /note="synthetic bacterial promoter"
     CDS             10317..10688
                     /label="BleoR"
                     /note="antibiotic-binding protein"
     polyA_signal    10821..10954
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(10991..11007)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(10991..11007)
                     /label="M13 Reverse"
                     /note="In lacZ gene. Also called M13-rev"
     primer_bind     complement(11004..11026)
                     /label="M13/pUC Reverse"
                     /note="In lacZ gene"
     protein_bind    11015..11031
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(11039..11069)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(11084..11105)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     primer_bind     complement(11222..11239)
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     rep_origin      complement(11393..11981)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(12155..13012)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(13013..13117)
                     /label="AmpR promoter"
     primer_bind     complement(13192..13211)
                     /label="pRS-marker"
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"
     enhancer        13383..13762
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        13763..13965
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     LTR             13980..14160
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    14207..14332
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    14825..15058
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             15243..15287
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             15436..15477
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    15585..15702
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"