Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V001281 | pHR-SFFV-KRAB-dCas9-P2A-mCherry | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pHR-SFFV-KRAB-dCas9-P2A-mCherry
- Antibiotic Resistance:
- Ampicillin
- Length:
- 14247 bp
- Type:
- Mammalian Expression, Lentiviral, CRISPR
- Replication origin:
- ori
- Selection Marker:
- mCherry
- Copy Number:
- High Copy
- Promoter:
- SFFV
- Cloning Method:
- Gibson Cloning
- 5' Primer:
- gcttcccgagctctataaaagag
- 3' Primer:
- CCAGAGGTTGATTATCGATAAGC
pHR-SFFV-KRAB-dCas9-P2A-mCherry vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pHR-SFFV-KRAB-dCas9-P2A-mCherry vector Sequence
LOCUS V001281 14247 bp DNA circular SYN 13-MAY-2021 DEFINITION Exported. ACCESSION V001281 VERSION V001281 KEYWORDS pHR-SFFV-KRAB-dCas9-P2A-mCherry SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 14247) AUTHORS Gilbert LA, Horlbeck MA, Adamson B, Villalta JE, Chen Y, Whitehead EH, Guimaraes C, Panning B, Ploegh HL, Bassik MC, Qi LS, Kampmann M, Weissman JS TITLE Genome-Scale CRISPR-Mediated Control of Gene Repression and Activation. JOURNAL Cell. 2014 Oct 23;159(3):647-61. doi: 10.1016/j.cell.2014.09.029. Epub 2014 Oct 9. PUBMED 25307932 REFERENCE 2 (bases 1 to 14247) TITLE Direct Submission REFERENCE 3 (bases 1 to 14247) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; doi: "10.1016/j.cell.2014.09.029"; journalName: "Cell"; date: "2014-10-23- 23"; volume: "159"; issue: "3"; pages: "647-61" SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..14247 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(1..17) /label="KS primer" /note="common sequencing primer, one of multiple similar variants" LTR 108..341 /label="3' LTR (Delta-U3)" /note="self-inactivating 3' long terminal repeat (LTR) from HIV-1" promoter complement(366..384) /label="SP6 promoter" /note="promoter for bacteriophage SP6 RNA polymerase" primer_bind complement(674..693) /label="pBRrevBam" /note="pBR322 vectors, tet region, downstream of BamHI, reverse primer" primer_bind complement(907..926) /label="pRS-marker" /note="pRS vectors, use to sequence yeast selectable marker" primer_bind 1026..1048 /label="pGEX 3'" /note="pGEX vectors, reverse primer" primer_bind complement(1086..1104) /label="pBRforEco" /note="pBR322 vectors, upsteam of EcoRI site, forward primer" promoter 1172..1276 /label="AmpR promoter" CDS 1277..2134 /label="AmpR" /note="beta-lactamase" rep_origin 2308..2896 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind 3050..3067 /label="L4440" /note="L4440 vector, forward primer" promoter 3142..3471 /label="SV40 promoter" /note="SV40 enhancer and early promoter" intron 4605..4670 /label="small t intron" /note="SV40 (simian virus 40) small t antigen intron" CDS 4800..4820 /label="SV40 NLS" /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" polyA_signal 5245..5379 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" LTR 5547..6180 /label="3' LTR" /note="3' long terminal repeat (LTR) from HIV-1" misc_feature 6227..6352 /label="HIV-1 Psi" /note="packaging signal of human immunodeficiency virus type 1" misc_feature 6849..7082 /label="RRE" /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 7267..7311 /label="gp41 peptide" /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 7460..7501 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" /label="Protein Tat" misc_feature 7596..7713 /label="cPPT/CTS" /note="central polypurine tract and central termination sequence of HIV-1" promoter 7866..8273 /label="SFFV promoter" /note="spleen focus-forming virus long terminal repeat (LTR) promoter" regulatory 8348..8357 /label="Kozak sequence" /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" CDS 8384..8569 /codon_start=1 /product="Kruppel-associated box (KRAB) transcriptional repression domain from the human zinc finger protein ZNF10 (Margolin et al., 1994)" /label="KRAB" /translation="RTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGY QLTKPDVILRLEKGEEP" CDS 8591..12694 /label="dCas9" /note="catalytically dead mutant of the Cas9 endonuclease from the Streptococcus pyogenes Type II CRISPR/Cas system" CDS 12698..12724 /codon_start=1 /product="HA (human influenza hemagglutinin) epitope tag" /label="HA" /translation="YPYDVPDYA" CDS 12743..12763 /codon_start=1 /product="nuclear localization signal of SV40 (simian virus 40) large T antigen" /label="SV40 NLS" /translation="PKKKRKV" CDS 12770..12790 /codon_start=1 /product="nuclear localization signal of SV40 (simian virus 40) large T antigen" /label="SV40 NLS" /translation="PKKKRKV" CDS 12830..12886 /codon_start=1 /product="2A peptide from porcine teschovirus-1 polyprotein" /label="P2A" /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="ATNFSLLKQAGDVEENPGP" CDS 12887..13594 /label="mCherry" /note="monomeric derivative of DsRed fluorescent protein (Shaner et al., 2004)" misc_feature 13657..14245 /label="WPRE" /note="woodchuck hepatitis virus posttranscriptional regulatory element"