pBOB-EF1-FastFUCCI-Puro vector (V001326)

Price Information

Cat No. Plasmid Name Availability Add to cart
V001326 pBOB-EF1-FastFUCCI-Puro In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pBOB-EF1-FastFUCCI-Puro
Antibiotic Resistance:
Ampicillin
Length:
12352 bp
Type:
Mammalian Expression, Lentiviral
Replication origin:
ori
Selection Marker:
Puromycin
Copy Number:
High Copy
Promoter:
EF-1α
Cloning Method:
Restriction Enzyme
5' Primer:
ggcattctgcacgcttca

pBOB-EF1-FastFUCCI-Puro vector Map

pBOB-EF1-FastFUCCI-Puro12352 bp60012001800240030003600420048005400600066007200780084009000960010200108001140012000CMV enhancerCMV promoter5' LTR (truncated)HIV-1 PsiRREgp41 peptideProtein TatcPPT/CTSEF-1-alpha promotermKO2Cdt1 (30-120)T2AmAzami-GreenGem1 (1-110)PGK promoterPuroRWPRE5' LTR (truncated)bGH poly(A) signalf1 oriSV40 promoterEM7 promoterBleoRSV40 poly(A) signalIn lacZ genelac promoterCAP binding siteL4440oriAmpRAmpR promoterpRS-marker

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pBOB-EF1-FastFUCCI-Puro vector Sequence

LOCUS       V001326                12352 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V001326
VERSION     V001326
KEYWORDS    pBOB-EF1-FastFUCCI-Puro
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 12352)
  AUTHORS   Koh SB, Mascalchi P, Rodriguez E, Lin Y, Jodrell DI, Richards FM,
            Lyons SK
  TITLE     Quantitative FastFUCCI assay defines cell cycle dynamics at
            single-cell level.
  JOURNAL   J Cell Sci. 2016 Nov 25. pii: jcs.195164.
   PUBMED   27888217
REFERENCE   2  (bases 1 to 12352)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 12352)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J Cell Sci.
            2016 Nov 25. pii: jcs.195164."
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12352
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        172..551
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        552..754
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     LTR             769..949
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    996..1121
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    1618..1851
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             2036..2080
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             2229..2270
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    2332..2448
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     promoter        2465..3643
                     /label="EF-1-alpha promoter"
                     /note="strong constitutive promoter for human elongation
                     factor EF-1-alpha"
     CDS             3664..4314
                     /label="mKO2"
                     /note="monomeric Kusabira-Orange 2 fluorescent protein"
     CDS             4369..4641
                     /label="Cdt1 (30-120)"
                     /note="degron consisting of residues 30-120 of human Cdt1
                     (Zielke and Edgar, 2015)"
     CDS             4648..4701
                     /codon_start=1
                     /product="2A peptide from Thosea asigna virus capsid
                     protein"
                     /label="T2A"
                     /note="Eukaryotic ribosomes fail to insert a peptide bond
                     between the Gly and Pro residues, yielding separate
                     polypeptides."
                     /translation="EGRGSLLTCGDVEENPGP"
     CDS             4708..5385
                     /codon_start=1
                     /product="monomeric Azami-Green fluorescent protein
                     (Karasawa et al., 2003)"
                     /label="mAzami-Green"
                     /translation="MVSVIKPEMKIKLCMRGTVNGHNFVIEGEGKGNPYEGTQILDLNV
                     TEGAPLPFAYDILTTVFQYGNRAFTKYPADIQDYFKQTFPEGYHWERSMTYEDQGICTA
                     TSNISMRGDCFFYDIRFDGTNFPPNGPVMQKKTLKWEPSTEKMYVEDGVLKGDVNMRLL
                     LEGGGHYRCDFKTTYKAKKEVRLPDAHKIDHRIEILKHDKDYNKVKLYENAVARYSMLP
                     SQAK"
     CDS             5416..5745
                     /label="Gem1 (1-110)"
                     /note="degron consisting of residues 1-110 of human Geminin
                     (Zielke and Edgar, 2015)"
     promoter        5788..6287
                     /label="PGK promoter"
                     /note="mouse phosphoglycerate kinase 1 promoter"
     CDS             6331..6927
                     /label="PuroR"
                     /note="puromycin N-acetyltransferase"
     misc_feature    7092..7680
                     /label="WPRE"
                     /note="woodchuck hepatitis virus posttranscriptional
                     regulatory element"
     LTR             8091..8271
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     polyA_signal    8303..8527
                     /label="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      8573..9001
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        9015..9344
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     promoter        9392..9439
                     /label="EM7 promoter"
                     /note="synthetic bacterial promoter"
     CDS             9458..9829
                     /label="BleoR"
                     /note="antibiotic-binding protein"
     polyA_signal    9962..10083
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(9999..10018)
                     /label="SV40pA-R"
                     /note="SV40 polyA, reverse primer"
     primer_bind     10053..10072
                     /label="EBV-rev"
                     /note="SV40 polyA terminator, reverse primer"
     primer_bind     complement(10132..10148)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(10132..10148)
                     /label="M13 Reverse"
                     /note="In lacZ gene. Also called M13-rev"
     primer_bind     complement(10145..10167)
                     /label="M13/pUC Reverse"
                     /note="In lacZ gene"
     protein_bind    10156..10172
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(10180..10210)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(10225..10246)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     primer_bind     complement(10363..10380)
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     rep_origin      complement(10534..11122)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(11296..12153)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(12154..12258)
                     /label="AmpR promoter"
     primer_bind     complement(12333..12352)
                     /label="pRS-marker"
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"