Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V001326 | pBOB-EF1-FastFUCCI-Puro | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pBOB-EF1-FastFUCCI-Puro
- Antibiotic Resistance:
- Ampicillin
- Length:
- 12352 bp
- Type:
- Mammalian Expression, Lentiviral
- Replication origin:
- ori
- Selection Marker:
- Puromycin
- Copy Number:
- High Copy
- Promoter:
- EF-1α
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- ggcattctgcacgcttca
pBOB-EF1-FastFUCCI-Puro vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pBOB-EF1-FastFUCCI-Puro vector Sequence
LOCUS V001326 12352 bp DNA circular SYN 13-MAY-2021 DEFINITION Exported. ACCESSION V001326 VERSION V001326 KEYWORDS pBOB-EF1-FastFUCCI-Puro SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 12352) AUTHORS Koh SB, Mascalchi P, Rodriguez E, Lin Y, Jodrell DI, Richards FM, Lyons SK TITLE Quantitative FastFUCCI assay defines cell cycle dynamics at single-cell level. JOURNAL J Cell Sci. 2016 Nov 25. pii: jcs.195164. PUBMED 27888217 REFERENCE 2 (bases 1 to 12352) TITLE Direct Submission REFERENCE 3 (bases 1 to 12352) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J Cell Sci. 2016 Nov 25. pii: jcs.195164." SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..12352 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 172..551 /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" promoter 552..754 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" LTR 769..949 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from HIV-1" misc_feature 996..1121 /label="HIV-1 Psi" /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1618..1851 /label="RRE" /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 2036..2080 /label="gp41 peptide" /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 2229..2270 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" /label="Protein Tat" misc_feature 2332..2448 /label="cPPT/CTS" /note="central polypurine tract and central termination sequence of HIV-1" promoter 2465..3643 /label="EF-1-alpha promoter" /note="strong constitutive promoter for human elongation factor EF-1-alpha" CDS 3664..4314 /label="mKO2" /note="monomeric Kusabira-Orange 2 fluorescent protein" CDS 4369..4641 /label="Cdt1 (30-120)" /note="degron consisting of residues 30-120 of human Cdt1 (Zielke and Edgar, 2015)" CDS 4648..4701 /codon_start=1 /product="2A peptide from Thosea asigna virus capsid protein" /label="T2A" /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="EGRGSLLTCGDVEENPGP" CDS 4708..5385 /codon_start=1 /product="monomeric Azami-Green fluorescent protein (Karasawa et al., 2003)" /label="mAzami-Green" /translation="MVSVIKPEMKIKLCMRGTVNGHNFVIEGEGKGNPYEGTQILDLNV TEGAPLPFAYDILTTVFQYGNRAFTKYPADIQDYFKQTFPEGYHWERSMTYEDQGICTA TSNISMRGDCFFYDIRFDGTNFPPNGPVMQKKTLKWEPSTEKMYVEDGVLKGDVNMRLL LEGGGHYRCDFKTTYKAKKEVRLPDAHKIDHRIEILKHDKDYNKVKLYENAVARYSMLP SQAK" CDS 5416..5745 /label="Gem1 (1-110)" /note="degron consisting of residues 1-110 of human Geminin (Zielke and Edgar, 2015)" promoter 5788..6287 /label="PGK promoter" /note="mouse phosphoglycerate kinase 1 promoter" CDS 6331..6927 /label="PuroR" /note="puromycin N-acetyltransferase" misc_feature 7092..7680 /label="WPRE" /note="woodchuck hepatitis virus posttranscriptional regulatory element" LTR 8091..8271 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from HIV-1" polyA_signal 8303..8527 /label="bGH poly(A) signal" /note="bovine growth hormone polyadenylation signal" rep_origin 8573..9001 /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 9015..9344 /label="SV40 promoter" /note="SV40 enhancer and early promoter" promoter 9392..9439 /label="EM7 promoter" /note="synthetic bacterial promoter" CDS 9458..9829 /label="BleoR" /note="antibiotic-binding protein" polyA_signal 9962..10083 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" primer_bind complement(9999..10018) /label="SV40pA-R" /note="SV40 polyA, reverse primer" primer_bind 10053..10072 /label="EBV-rev" /note="SV40 polyA terminator, reverse primer" primer_bind complement(10132..10148) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" primer_bind complement(10132..10148) /label="M13 Reverse" /note="In lacZ gene. Also called M13-rev" primer_bind complement(10145..10167) /label="M13/pUC Reverse" /note="In lacZ gene" protein_bind 10156..10172 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(10180..10210) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(10225..10246) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." primer_bind complement(10363..10380) /label="L4440" /note="L4440 vector, forward primer" rep_origin complement(10534..11122) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(11296..12153) /label="AmpR" /note="beta-lactamase" promoter complement(12154..12258) /label="AmpR promoter" primer_bind complement(12333..12352) /label="pRS-marker" /note="pRS vectors, use to sequence yeast selectable marker"