Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V001365 | pHCMV-AmphoEnv | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pHCMV-AmphoEnv
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6796 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Copy Number:
- High Copy
- Cloning Method:
- Restriction Enzyme
pHCMV-AmphoEnv vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pHCMV-AmphoEnv vector Sequence
LOCUS 40924_24323 6796 bp DNA circular SYN 13-MAY-2021
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6796)
AUTHORS Sena-Esteves M, Tebbets JC, Steffens S, Crombleholme T, Flake AW
TITLE Optimized large-scale production of high titer lentivirus vector
pseudotypes.
JOURNAL J Virol Methods. 2004 Dec 15. 122(2):131-9.
PUBMED 15542136
REFERENCE 2 (bases 1 to 6796)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 6796)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J Virol
Methods. 2004 Dec 15. 122(2):131-9."
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6796
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 97..476
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 477..680
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
primer_bind 677..701
/label=LNCX
/note="Human CMV promoter, forward primer"
intron 792..1364
/label=beta-globin intron
/note="intron from rabbit beta-globin gene"
CDS 1441..3402
/codon_start=1
/label=env
/note="murine leukemia virus gPr80 envelope polyprotein
precursor"
/translation="MARSTLSKPPQDKINPWKPLIVMGVLLGVGMAESPHQVFNVTWRV
TNLMTGRTANATSLLGTVQDAFPKLYFDLCDLVGEEWDPSDQEPYVGYGCKYPAGRQRT
RTFDFYVCPGHTVKSGCGGPGEGYCGKWGCETTGQAYWKPTSSWDLISLKRGNTPWDTG
CSKVACGPCYDLSKVSNSFQGATRGGRCNPLVLEFTDAGKKANWDGPKSWGLRLYRTGT
DPITMFSLTRQVLNVGPRVPIGPNPVLPDQRLPSSPIEIVPAPQPPSPLNTSYPPSTTS
TPSTSPTSPSVPQPPPGTGDRLLALVKGAYQALNLTNPDKTQECWLCLVSGPPYYEGVA
VVGTYTNHSTAPANCTATSQHKLTLSEVTGQGLCMGAVPKTHQALCNTTQSAGSGSYYL
AAPAGTMWACSTGLTPCLSTTVLNLTTDYCVLVELWPRVIYHSPDYMYGQLEQRTKYKR
EPVSLTLALLLGGLTMGGIAAGIGTGTTALIKTQQFEQLHAAIQTDLNEVEKSITNLEK
SLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHTGLVRDSMAKLRERLNQRQ
KLFETGQGWFEGLFNRSPWFTTLISTIMGPLIVLLLILLFGPCILNRLVQFVKDRISVV
QALVLTQQYHQLKPIEYEP"
primer_bind complement(3500..3519)
/label=Bglob-pA-R
/note="Rabbit beta-globin polyA region, reverse primer"
polyA_signal 3565..3620
/label=beta-globin poly(A) signal
/note="rabbit beta-globin polyadenylation signal (Gil and
Proudfoot, 1987)"
primer_bind complement(3619..3638)
/label=rbglobpA-R
/note="Rabbit beta-globin polyA, reverse primer. Also
called rb-glob-pA-term-R"
primer_bind complement(3978..3994)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4002..4018)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4026..4056)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4071..4092)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
primer_bind complement(4209..4226)
/label=L4440
/note="L4440 vector, forward primer"
rep_origin complement(4380..4968)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(5437..5816)
/label=ISS
/note="immunostimulatory sequence from the AmpR gene;
contains unmethylated CpG dinucleotides in the context of
5'-AACGTT-3' (Sato et al., 1996)"
promoter complement(6001..6105)
/label=AmpR promoter
rep_origin complement(6131..6586)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 6728..6744
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 6754..6772
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"