Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V001452 | pHT01 | In stock, instant shipping |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
The pHT01 is a E. coli - B. subtilis shuttle vector.
- Vector Name:
- pHT01
- Antibiotic Resistance:
- Ampicillin, Chloramphenicol
- Length:
- 7956 bp
- Type:
- Bacillus subtilis expression vectors
- Replication origin:
- ori
- Promoter:
- grac
- Growth Strain(s):
- Top10
- Growth Temperature:
- 37℃
pHT01 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Babar TK, Glare TR, Hampton JG, Hurst MRH, Narciso J, Sheen CR, Koch B. Linocin M18 protein from the insect pathogenic bacterium Brevibacillus laterosporus isolates. Appl Microbiol Biotechnol. 2023 Jul;107(13):4337-4353. doi: 10.1007/s00253-023-12563-8. Epub 2023 May 19. PMID: 37204448; PMCID: PMC10313851.
pHT01 vector Sequence
LOCUS Exported 7956 bp DNA circular SYN 27-AUG-2024 DEFINITION Exported. ACCESSION V001452 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7956) TITLE Direct Submission REFERENCE 2 (bases 1 to 7956) TITLE Direct Submission REFERENCE 3 (bases 1 to 7956) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..7956 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(116..763) /gene="cat" /label=Chloramphenicol acetyltransferase /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" primer_bind 1239..1255 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(1301..2380) /label=lacI /note="lac repressor" promoter 2684..2803 /label=Pgrac protein_bind 2764..2788 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." terminator 2833..2858 /label=trp terminator CDS 2922..3185 /codon_start=1 /label=ParA family protein /translation="MVETYEANIGLLGIVPVLIKSGGSVDQYILDEARKEFGDDLLNST IKLRERIKRFDVQGITEEDTHDKEALKLFNNLTMELIERVEG" CDS 3883..4917 /codon_start=1 /label=helix-turn-helix domain-containing protein /translation="MSEVNLKGNTDELVYYRQQTTGNKIARKRIKKGKEEVYYVAETEE KIWTEEQIKNFSLDKFGTHIPYIEGHYTILNNYFFDFWGYFLGAEGIALYAHLTRYAYG SKDFCFPSLQTIAKKMDKTPVTVRGYLKLLERYGFIWKVNVRNKTKDNTEESPIFKIRR KVPLLSEELLNGNPNIEIPDDEEAHVKKALKKEKEGLPKVLKKEHDEFVKKMMDESETI NIPEALQYDTMYEDILSKGEIRKEIKKQIPNPTTSFESISMTTEEEKVDSTLKSEMQNR VSKPSFDTWFKNTKIKIENKNCLLLVPSEFAFEWIKKRYLETIKTVLEEAGYVFEKIEL RKVQ" CDS complement(5293..5799) /codon_start=1 /label=ORF-2 /translation="MPYSPTLLEGAVSDILLHKKILSPKDLRPEFLSKRFGIEIMTGKT SYAYIDSDVKVFVLDKKVEEKERNYQFHKLFAHTLLHEENHLEIPMEVYEKHSEEAERL TWVEAIPYHMLRYIDFSDPEFIKQASDVFYIPEKVVQNRINFMIQQQFEIDEFDNVNEK VKSFA" promoter 6033..6137 /label=AmpR promoter CDS 6138..6995 /label=AmpR /note="beta-lactamase" rep_origin 7169..7757 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"