Basic Vector Information
- Vector Name:
- yrbE1AB
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6299 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Joshi SM, Pandey AK, Capite N, Fortune SM, Rubin EJ, Sassetti CM.
yrbE1AB vector Map
yrbE1AB vector Sequence
LOCUS V001470 6299 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V001470 VERSION V001470 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6299) AUTHORS Joshi SM, Pandey AK, Capite N, Fortune SM, Rubin EJ, Sassetti CM. TITLE Characterization of mycobacterial virulence genes through genetic interaction mapping JOURNAL Proc. Natl. Acad. Sci. U.S.A. 103 (31), 11760-11765 (2006) PUBMED 16868085 REFERENCE 2 (bases 1 to 6299) AUTHORS Joshi SM, Pandey AK, Capite NM, Fortune SM, Rubin EJ, Sassetti CM. TITLE Direct Submission JOURNAL Submitted (26-JUN-2006) Molecular Genetics and Microbiology, University of Massachusetts Medical School, 55 Lake Ave. North, Worcester, MA 01655, USA REFERENCE 3 (bases 1 to 6299) TITLE Direct Submission REFERENCE 4 (bases 1 to 6299) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2006"; volume: "103"; issue: "31"; pages: "11760-11765" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-JUN-2006) Molecular Genetics and Microbiology, University of Massachusetts Medical School, 55 Lake Ave. North, Worcester, MA 01655, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6299 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 7..394 /note="promoter from Mycobacterium tuberculosis groEL2 gene" /regulatory_class="promoter" CDS 446..1243 /codon_start=1 /gene="yrbE1A" /product="YrbE1A" /label="yrbE1A" /protein_id="ABG72765.1" /translation="MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWRE FILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPL TTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGL VITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRG LTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR" gene 446..1243 /gene="yrbE1A" /label="yrbE1A" CDS 2118..2144 /label="HA" /note="HA (human influenza hemagglutinin) epitope tag" terminator 2200..2246 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" CDS complement(2298..3293) /gene="hyg" /label="Hygromycin-B 7''-O-kinase" /note="Hygromycin-B 7''-O-kinase from Streptomyces hygroscopicus. Accession#: P09979" rep_origin 3632..4220 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" rep_origin 4379..6273 /label="mycobacterial origin of replication from pAL5000" /note="mycobacterial origin of replication from pAL5000"
This page is informational only.