Basic Vector Information
- Vector Name:
- yGALset986
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5586 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Enomoto S, Chen G, Berman J.
- Promoter:
- GAL1,10
yGALset986 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
yGALset986 vector Sequence
LOCUS 40924_49727 5586 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector yGALset986, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5586) AUTHORS Enomoto S, Chen G, Berman J. TITLE Vectors for expressing T7 epitope- and His6 affinity-tagged fusion proteins in S. cerevisiae JOURNAL BioTechniques 24 (5), 782-786 (1998) PUBMED 9591127 REFERENCE 2 (bases 1 to 5586) AUTHORS Enomoto S, Berman J. TITLE Direct Submission JOURNAL Submitted (09-JAN-1998) Plant Biology, University of Minnesota, 220 Biological Sciences Center, St. Paul, MN 55108, USA REFERENCE 3 (bases 1 to 5586) TITLE Direct Submission REFERENCE 4 (bases 1 to 5586) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BioTechniques"; date: "1998"; volume: "24"; issue: "5"; pages: "782-786" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-JAN-1998) Plant Biology, University of Minnesota, 220 Biological Sciences Center, St. Paul, MN 55108, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5586 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 70..88 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter complement(121..785) /label=GAL1,10 promoter /note="divergent inducible promoter, regulated by Gal4" RBS 804..826 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 846..863 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 867..899 /codon_start=1 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" /translation="MASMTGGQQMG" CDS 903..926 /codon_start=1 /label=Xpress(TM) tag /note="Xpress(TM) epitope tag, including an enterokinase recognition and cleavage site" /translation="DLYDDDDK" misc_feature 936..982 /label=multiple cloning sites /note="multiple cloning sites" terminator 1046..1093 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 1193..1648 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(1912..2568) /codon_start=1 /label=HIS3 /note="imidazoleglycerol-phosphate dehydratase, required for histidine biosynthesis" /translation="MTEQKALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAE QATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALGQAF KEALLARGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGLQREKVGDLSCEMIPHFL ESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATSPNGTNDVPSTKGVLM" promoter complement(2569..2756) /label=HIS3 promoter misc_feature complement(3140..3643) /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" promoter 3680..3784 /label=AmpR promoter CDS 3785..4642 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 4816..5404 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.