Basic Vector Information
- Vector Name:
- VEE(L.Cm).Pac-2A-GFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 14800 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Kim YG, Baltabekova AZ, Shustov AV.
VEE(L.Cm).Pac-2A-GFP vector Map
VEE(L.Cm).Pac-2A-GFP vector Sequence
LOCUS V001515 14800 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V001515 VERSION V001515 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 14800) AUTHORS Kim YG, Baltabekova AZ, Shustov AV. TITLE Poxvirus' interferon inhibitor B18R: recombinant expression, refolding and use in mammalian expression system based on viral vectors JOURNAL Unpublished REFERENCE 2 (bases 1 to 14800) AUTHORS Kim YG, Baltabekova AZ, Shustov AV. TITLE Direct Submission JOURNAL Submitted (18-MAY-2017) National Center for Biotechnology, Korgalzhin hwy 13/5, Astana, Akmola region 010000, Kazakhstan REFERENCE 3 (bases 1 to 14800) TITLE Direct Submission REFERENCE 4 (bases 1 to 14800) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-MAY-2017) National Center for Biotechnology, Korgalzhin hwy 13/5, Astana, Akmola region 010000, Kazakhstan" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..14800 /mol_type="other DNA" /organism="synthetic DNA construct" RBS 1536..1544 /label="Shine-Dalgarno sequence" /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 7576..8172 /codon_start=1 /gene="pac from Streptomyces" /product="puromycin N-acetyltransferase" /label="PuroR" /note="confers resistance to puromycin" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS APRNLPFYERLGFTVTADVECPKDRATWCMTRKPGA" CDS 8224..8940 /label="EGFP" /note="enhanced GFP" CDS 9063..12827 /note="Structural polyprotein from Venezuelan equine encephalitis virus (strain 3880). Accession#: P36329" /label="Structural polyprotein" promoter 13038..13142 /label="AmpR promoter" CDS 13143..14000 /label="AmpR" /note="beta-lactamase" rep_origin 14174..14762 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.