pCVD057 vector (V001530)

Download GeneBank File(.gb)

LOCUS       40924_49267        5227 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Broad host range vector vector pCVD057, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5227)
  AUTHORS   Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, 
            Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
  TITLE     Broad-host-range vector system for synthetic biology and 
            biotechnology in cyanobacteria
  JOURNAL   Nucleic Acids Res. (2014) In press
  PUBMED    25074377
REFERENCE   2  (bases 1 to 5227)
  AUTHORS   Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, 
            Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUN-2014) Division of Biological Sciences, University 
            of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA
REFERENCE   3  (bases 1 to 5227)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5227)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic 
            Acids Res. (2014) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (17-JUN-2014) Division of Biological Sciences, University of 
            California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5227
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     379..395
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    405..410
                     /label=ZraI
                     /note="ZraI"
     misc_feature    408..428
                     /note="G5C5; GC-adaptor for seamless assembly, flanking a
                     BHR replicons, neutral sites, or cyanobacterial replicons; 
                     synthetic"
     misc_feature    429..434
                     /label=XbaI
                     /note="XbaI"
     CDS             complement(585..1892)
                     /codon_start=1
                     /product="repA-pFDA"
                     /label=repA-pFDA
                     /note="repA-pFDA; derived from pPL2; 7; Fremyella
                     diplosiphon PCC7601"
                     /protein_id="AII99656.1"
                     /translation="MKHTTFPHSNIIAQSTATEGENFVLQTRLHASILLLTPASKLWYL
                     CRALDLSGRGYVVLSPQNLELLQEKKSTIYRWLKDGKDLGLFRCYSWAGNTLKISLGSL
                     WRACKKARIKNWGTVANNIPLEEILKNNGRRTVATAMTIQDWQERSRYAAKNQLNPLER
                     KCFEIPATADVLTPQTSPKLTSGGTTGVLHVGEKRIFVGRSFIPFGVSQKRISNELNSQ
                     PASCGVSVRTVQRHVERLEVKHRQLMQARREYREIAHRIKQGATSWQCKSDADISFTWG
                     NQPDEIVLHERNGKSSARREGGHTIKLDQLCNYSNTHWRYRCNLYLLSYELTSMRTTRY
                     QWKKRGLNVKIAPVENCPSEISPQTPEMLESPKLHAEGRGLGGQNKSVKNENPQEVDTV
                     SNAFAPGGSEWAKTKAMLLAKQAERRQKRWDSLNSI"
     misc_feature    1152..1157
                     /label=MfeI
                     /note="MfeI"
     regulatory      complement(1893..2554)
                     /note="PrepA; 662 nts upstream of repA-pFDA; derived from 
                     pPL2.7; Fremyella diplosiphon PCC7601"
                     /regulatory_class="promoter"
     misc_feature    2417..2422
                     /label=EcoRV
                     /note="EcoRV"
     misc_feature    2555..2560
                     /label=SacI
                     /note="SacI"
     protein_bind    2574..2595
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        2610..2640
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2648..2664
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             2685..2858
                     /label=lacZ-alpha
                     /note="LacZ-alpha fragment of beta-galactosidase"
     misc_feature    2916..2921
                     /label=SacI
                     /note="SacI"
     misc_feature    2922..2942
                     /note="C3G3; GC-adaptor for seamless assembly, flanking 
                     cyanobacterial replicons; synthetic"
     misc_feature    2940..2945
                     /label=ZraI
                     /note="ZraI"
     misc_feature    2964..2969
                     /label=XbaI
                     /note="XbaI"
     primer_bind     complement(3006..3022)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(3030..3046)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3054..3084)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3099..3120)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(3408..3996)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4170..5027)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(5028..5132)
                     /label=AmpR promoter
     misc_feature    5158..5163
                     /label=ZraI
                     /note="ZraI"