Basic Vector Information
- Vector Name:
- pCVD056
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4866 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD056 vector Map
pCVD056 vector Sequence
LOCUS 40924_49262 4866 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD056, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4866) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 4866) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 4866) TITLE Direct Submission REFERENCE 4 (bases 1 to 4866) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4866 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 405..410 /label=ZraI /note="ZraI" misc_feature 408..2581 /note="CVD-CYA; device for the GC-adaptor assembly: cyanobacterial replicons" misc_feature 408..428 /note="G5C5; GC-adaptor for seamless assembly, flanking a BHR replicons, neutral sites, or cyanobacterial replicons; synthetic" misc_feature 429..434 /label=XbaI /note="XbaI" CDS complement(585..1892) /codon_start=1 /product="repA-pFDA" /label=repA-pFDA /note="repA-pFDA; derived from pPL2; 7; Fremyella diplosiphon PCC7601" /protein_id="AII99654.1" /translation="MKHTTFPHSNIIAQSTATEGENFVLQTRLHASILLLTPASKLWYL CRALDLSGRGYVVLSPQNLELLQEKKSTIYRWLKDGKDLGLFRCYSWAGNTLKISLGSL WRACKKARIKNWGTVANNIPLEEILKNNGRRTVATAMTIQDWQERSRYAAKNQLNPLER KCFEIPATADVLTPQTSPKLTSGGTTGVLHVGEKRIFVGRSFIPFGVSQKRISNELNSQ PASCGVSVRTVQRHVERLEVKHRQLMQARREYREIAHRIKQGATSWQCKSDADISFTWG NQPDEIVLHERNGKSSARREGGHTIKLDQLCNYSNTHWRYRCNLYLLSYELTSMRTTRY QWKKRGLNVKIAPVENCPSEISPQTPEMLESPKLHAEGRGLGGQNKSVKNENPQEVDTV SNAFAPGGSEWAKTKAMLLAKQAERRQKRWDSLNSI" misc_feature 1152..1157 /label=MfeI /note="MfeI" regulatory complement(1893..2554) /note="PrepA; 662 nts upstream of repA-pFDA; derived from pPL2.7; Fremyella diplosiphon PCC7601" /regulatory_class="promoter" misc_feature 2417..2422 /label=EcoRV /note="EcoRV" misc_feature 2555..2560 /label=MfeI /note="MfeI" misc_feature 2561..2581 /note="C3G3; GC-adaptor for seamless assembly, flanking cyanobacterial replicons; synthetic" misc_feature 2579..2584 /label=ZraI /note="ZraI" misc_feature 2603..2608 /label=XbaI /note="XbaI" primer_bind complement(2645..2661) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2669..2685) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2693..2723) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2738..2759) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3047..3635) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3809..4666) /label=AmpR /note="beta-lactamase" promoter complement(4667..4771) /label=AmpR promoter misc_feature 4797..4802 /label=ZraI /note="ZraI"
This page is informational only.