Basic Vector Information
- Vector Name:
- pCVD055
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5021 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD055 vector Vector Map
pCVD055 vector Sequence
LOCUS 40924_49257 5021 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD055, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5021) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 5021) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 5021) TITLE Direct Submission REFERENCE 4 (bases 1 to 5021) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5021 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 405..410 /label=ZraI /note="ZraI" misc_feature 408..428 /note="G5C5; GC-adaptor for seamless assembly, flanking a BHR replicons, neutral sites, or cyanobacterial replicons; synthetic" misc_feature 429..434 /label=XbaI /note="XbaI" regulatory complement(471..498) /note="rho-ITTS; rho-ITTS; rho-independent transcriptional termination signal, downstream of repA in pDU1, from pAM505; Nostoc sp. PCC7524" /regulatory_class="terminator" CDS complement(577..1698) /codon_start=1 /product="repA" /label=repA /note="repA-pDU1; derived from pAM0505; Nostoc sp. PCC7524" /protein_id="AII99687.1" /translation="MISPESLNTNVSLTLLTRELQTEIILGTYTVRVHTRIGREPCARL WYLCRALDKDGSGHLTLPLPVVQTFLDCSDKSVYRWLQDGKKIGAFRRYKIKAGMITVY LGGMFQVCYNLNLKRWGDVAVVPLVQVLSDLRSLTTGIVTQSFQQKSRYAANRQLKPEY RKLFGAPHPNELVKDTRQSSLKSPEGEVPCVLHISSSRIFVSKSFIHYGTSQKAVSCEL GIHKRTVRRHQKQLGMNRRQLCQAKIEYNQLRHARNNDASEFWAFTGTKTDIGYQVMGD AVVFSDGIAPGAKKRQPNTYQIDATEFDGRLFKVGDKVFMNRCNIYREQFTLTTMSAAR RKYHFKLSQCHFSENRAGRVGNRFVIGCHSGEI" misc_feature 877..882 /label=EcoRV /note="EcoRV" regulatory complement(1699..2348) /note="PrepA; PrepA; upstream region of repA of pDU1 including promoter and ribosomal binding site,derived from pAM505; Nostoc sp. PCC7524" /regulatory_class="promoter" misc_feature 1944..1949 /label=MfeI /note="MfeI" misc_feature 2349..2354 /label=SacI /note="SacI" protein_bind 2368..2389 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2404..2434 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2442..2458 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 2479..2652 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" misc_feature 2710..2715 /label=SacI /note="SacI" misc_feature 2716..2736 /note="C3G3; GC-adaptor for seamless assembly, flanking cyanobacterial replicons; synthetic" misc_feature 2734..2739 /label=ZraI /note="ZraI" misc_feature 2758..2763 /label=XbaI /note="XbaI" primer_bind complement(2800..2816) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2824..2840) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2848..2878) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2893..2914) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3202..3790) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3964..4821) /label=AmpR /note="beta-lactamase" promoter complement(4822..4926) /label=AmpR promoter misc_feature 4952..4957 /label=ZraI /note="ZraI"
This page is informational only.