Basic Vector Information
- Vector Name:
- pCVD053
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6061 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD053 vector Vector Map
pCVD053 vector Sequence
LOCUS 40924_49247 6061 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD053, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6061) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 6061) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 6061) TITLE Direct Submission REFERENCE 4 (bases 1 to 6061) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6061 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 405..410 /label=ZraI /note="ZraI" misc_feature 408..3776 /note="CVD-CYA; device for the GC-adaptor assembly: cyanobacterial replicons" misc_feature 408..428 /note="G5C5; GC-adaptor for seamless assembly, flanking a BHR replicons, neutral sites, or cyanobacterial replicons; synthetic" misc_feature 429..434 /label=XbaI /note="XbaI" misc_feature 496..501 /label=XbaI /note="XbaI" CDS 806..1357 /codon_start=1 /product="orfC" /label=orfC /note="orfC-pDU1; derived from pAM0505; integrase/recombinase plasmid stability; similar to INSD accession AAM76170; Nostoc sp. PCC7524" /protein_id="AII99682.1" /translation="MKVNGNGRAKILTSDELRRLFSDGFTTPRDRVLFGICLFTGCRVS EALALQTTDIKGETLTFRKSTTKGKLKTRVVDIQPGLAALMADYHPKPGTLFPGMRGVS DRLTRYAADKILRDAAKRIGLEGISTHSFRRTALNQMSSAGIPLRHIQEISGHNDLGTL QRYLEVTPEQRRKAVSVIGF" misc_feature 923..928 /label=AgeI /note="AgeI" misc_feature 1264..1269 /label=EcoRV /note="EcoRV" misc_feature 1456..1461 /label=XbaI /note="XbaI" regulatory complement(1872..1899) /note="rho-ITTS; rho-ITTS; rho-independent transcriptional termination signal, downstream of repA in pDU1, from pAM505; Nostoc sp. PCC7524" /regulatory_class="terminator" CDS complement(1978..3099) /codon_start=1 /product="repA" /label=repA /note="repA-pDU1; derived from pAM0505; Nostoc sp. PCC7524" /protein_id="AII99683.1" /translation="MISPESLNTNVSLTLLTRELQTEIILGTYTVRVHTRIGREPCARL WYLCRALDKDGSGHLTLPLPVVQTFLDCSDKSVYRWLQDGKKIGAFRRYKIKAGMITVY LGGMFQVCYNLNLKRWGDVAVVPLVQVLSDLRSLTTGIVTQSFQQKSRYAANRQLKPEY RKLFGAPHPNELVKDTRQSSLKSPEGEVPCVLHISSSRIFVSKSFIHYGTSQKAVSCEL GIHKRTVRRHQKQLGMNRRQLCQAKIEYNQLRHARNNDASEFWAFTGTKTDIGYQVMGD AVVFSDGIAPGAKKRQPNTYQIDATEFDGRLFKVGDKVFMNRCNIYREQFTLTTMSAAR RKYHFKLSQCHFSENRAGRVGNRFVIGCHSGEI" misc_feature 2278..2283 /label=EcoRV /note="EcoRV" regulatory complement(3100..3749) /note="PrepA; PrepA; upstream region of repA of pDU1 including promoter and ribosomal binding site,derived from pAM505; Nostoc sp. PCC7524" /regulatory_class="promoter" misc_feature 3345..3350 /label=MfeI /note="MfeI" misc_feature 3750..3755 /label=MfeI /note="MfeI" misc_feature 3756..3776 /note="C3G3; GC-adaptor for seamless assembly, flanking cyanobacterial replicons; synthetic" misc_feature 3774..3779 /label=ZraI /note="ZraI" misc_feature 3798..3803 /label=XbaI /note="XbaI" primer_bind complement(3840..3856) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3864..3880) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3888..3918) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3933..3954) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4242..4830) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5004..5861) /label=AmpR /note="beta-lactamase" promoter complement(5862..5966) /label=AmpR promoter misc_feature 5992..5997 /label=ZraI /note="ZraI"
This page is informational only.