Basic Vector Information
- Vector Name:
- pCVD050
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4989 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD050 vector Vector Map
pCVD050 vector Sequence
LOCUS 40924_49232 4989 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD050, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4989) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 4989) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 4989) TITLE Direct Submission REFERENCE 4 (bases 1 to 4989) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4989 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 405..410 /label=EcoRV /note="EcoRV" misc_feature 408..428 /note="G5C5; GC-adaptor for seamless assembly, flanking functional devices, custom sequences or cyanobacterial replicons; synthetic" misc_feature 429..434 /label=XbaI /note="XbaI" CDS complement(600..1634) /codon_start=1 /product="repA" /label=repA /note="repA-pDC1; derived from pSUN202; Nostoc sp. PCC8009" /protein_id="AII99670.1" /translation="MANQNRAATQVEGLNHCPLTSQEDRSALSSNVPLPLVLILVKAEI ILQPFMVRLHSGISRQPWARLWYLLRGFDDGSGRVKEIPLVLVEEILGVSQATVYRWLD QGKAVGAFLSGYKVRIGLLTVYLGGLTKVAWHLNLKDWGVVAECPLWEVNANIRALTTG IVTQRLQQRSRYAANRKLKPEYRKSYGAPHPNELLGDEGQSSFKLGAGEVPFVLHVSPS RVFVSKSFIHYGTSQNAVSCKLGIHTRTVRRHQRTLGMEKRQLCQAKYEYAQLDRAVSN EASECWAWSSEGTQSDIGYQSLGISHWVKGRSRFLMASCQEPESSSRTLTSCQRANCLG VSSK" misc_feature 1221..1228 /label=SwaI /note="SwaI" regulatory complement(1635..2316) /note="PrepA; 682 nts upstream of repA-pDC1; derived from pSUN202; Nostoc sp. PCC8009" /regulatory_class="promoter" misc_feature 2113..2118 /label=MfeI /note="MfeI" misc_feature 2317..2322 /label=SacI /note="SacI" protein_bind 2336..2357 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2372..2402 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2410..2426 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 2447..2620 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" misc_feature 2678..2683 /label=SacI /note="SacI" misc_feature 2684..2704 /note="C3G3; GC-adaptor for seamless assembly, flanking cyanobacterial replicons or Escherichia coli origins to be assembled with a cyanobacterial replicon; synthetic" misc_feature 2702..2707 /label=EcoRV /note="EcoRV" misc_feature 2726..2731 /label=XbaI /note="XbaI" primer_bind complement(2768..2784) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2792..2808) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2816..2846) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2861..2882) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3170..3758) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3932..4789) /label=AmpR /note="beta-lactamase" promoter complement(4790..4894) /label=AmpR promoter misc_feature 4920..4925 /label=ZraI /note="ZraI"
This page is informational only.