Basic Vector Information
- Vector Name:
- pCVD049
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4588 bp
- Type:
- Broad host range vector
- Replication origin:
- ori
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD049 vector Vector Map
pCVD049 vector Sequence
LOCUS 40924_49227 4588 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD049, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4588) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 4588) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 4588) TITLE Direct Submission REFERENCE 4 (bases 1 to 4588) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4588 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 405..410 /label=EcoRV /note="EcoRV" misc_feature 408..2303 /note="CVD-CYA; device for the GC-adaptor assembly: cyanobacterial replicons" misc_feature 408..428 /note="G5C5; GC-adaptor for seamless assembly, flanking functional devices, custom sequences or cyanobacterial replicons; synthetic" misc_feature 429..434 /label=XbaI /note="XbaI" CDS 585..1619 /codon_start=1 /product="repA" /label=repA /note="repA-pDC1; derived from pSUN202; Nostoc sp. PCC8009" /protein_id="AII99715.1" /translation="MANQNRAATQVEGLNHCPLTSQEDRSALSSNVPLPLVLILVKAEI ILQPFMVRLHSGISRQPWARLWYLLRGFDDGSGRVKEIPLVLVEEILGVSQATVYRWLD QGKAVGAFLSGYKVRIGLLTVYLGGLTKVAWHLNLKDWGVVAECPLWEVNANIRALTTG IVTQRLQQRSRYAANRKLKPEYRKSYGAPHPNELLGDEGQSSFKLGAGEVPFVLHVSPS RVFVSKSFIHYGTSQNAVSCKLGIHTRTVRRHQRTLGMEKRQLCQAKYEYAQLDRAVSN EASECWAWSSEGTQSDIGYQSLGISHWVKGRSRFLMASCQEPESSSRTLTSCQRANCLG VSSK" misc_feature 991..998 /label=SwaI /note="SwaI" misc_feature 2277..2282 /label=MfeI /note="MfeI" misc_feature 2283..2303 /note="C3G3; GC-adaptor for seamless assembly, flanking cyanobacterial replicons or Escherichia coli origins to be assembled with a cyanobacterial replicon; synthetic" misc_feature 2301..2306 /label=EcoRV /note="EcoRV" misc_feature 2325..2330 /label=XbaI /note="XbaI" primer_bind complement(2367..2383) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2391..2407) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2415..2445) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2460..2481) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2769..3357) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3531..4388) /label=AmpR /note="beta-lactamase" promoter complement(4389..4493) /label=AmpR promoter misc_feature 4519..4524 /label=ZraI /note="ZraI"
This page is informational only.