Basic Vector Information
- Vector Name:
- pCVD047
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7140 bp
- Type:
- Broad host range vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD047 vector Vector Map
pCVD047 vector Sequence
LOCUS 40924_49217 7140 bp DNA circular SYN 18-DEC-2018 DEFINITION Broad host range vector vector pCVD047, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7140) AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW. TITLE Broad-host-range vector system for synthetic biology and biotechnology in cyanobacteria JOURNAL Nucleic Acids Res. (2014) In press PUBMED 25074377 REFERENCE 2 (bases 1 to 7140) AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA REFERENCE 3 (bases 1 to 7140) TITLE Direct Submission REFERENCE 4 (bases 1 to 7140) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic Acids Res. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Division of Biological Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7140 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(124..981) /label=AmpR /note="beta-lactamase" promoter complement(982..1086) /label=AmpR promoter misc_feature 1112..1117 /label=ZraI /note="ZraI" misc_feature 1227..1232 /label=ZraI /note="ZraI" misc_feature 1230..1250 /note="G5C5; GC-adaptor for seamless assembly, flanking a BHR replicons, neutral sites, or cyanobacterial replicons; synthetic" misc_feature 1251..1256 /label=XbaI /note="XbaI" regulatory 1288..1314 /note="trpA T; trpA terminator from Lorist6 INSD accession X98450, one nt shorter than reference; Lorist6" /regulatory_class="terminator" CDS complement(1650..2498) /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(2488..3324) /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(3354..3560) /codon_start=1 /product="repF" /label=repF /note="repF-RSF1010; replication gene; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829" /protein_id="AII99706.1" /translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY EALRECLEELRAAQGGGSDPASA" CDS complement(3562..3774) /codon_start=1 /product="repE" /label=repE /note="repE-RSF1010; replication gene; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829" /protein_id="AII99707.1" /translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS LNLDGCTLSLFREDKPFGPGKFLGD" regulatory complement(3804..3831) /note="P4; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829; the P4 promoter is under the auto-regulated control of the F repressor, whose gene is located in the same operon, providing transcription of E-F-repA-repC-operon" /regulatory_class="promoter" CDS complement(3838..4806) /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS complement(4803..5216) /codon_start=1 /product="mobB" /label=mobB /note="mobilization gene; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829" /protein_id="AII99704.1" /translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR" misc_feature 5662..5667 /label=AgeI /note="AgeI" oriT complement(6045..6132) /direction=LEFT /label=RSF1010 oriT /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" regulatory complement(6141..6172) /note="P1; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829; the P1 promoter is controlled by MobC and MobA provide transcription of mobA/repB, mobB, and, probably, E-F-repA-repC-operon" /regulatory_class="promoter" CDS 6163..6447 /codon_start=1 /product="mobC" /label=mobC /note="mobilization gene; derived from pRL1383a in INSD accession AF403426, a derivative of RSF1010 INSD accession M28829" /protein_id="AII99703.1" /translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG" rep_origin 6474..6868 /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" terminator complement(7035..7078) /label=bacterial terminator /note="putative bacterial transcription terminator" regulatory complement(7044..7072) /note="TrrnC; rrnC terminator from Lorist6 INSD accession X98450; Lorist6" /regulatory_class="terminator" misc_feature 7111..7116 /label=NheI /note="NheI" misc_feature 7117..7137 /note="GC; GC-adaptor for seamless assembly, flanking BHR replicons or neutral sites; synthetic" misc_feature 7135..7140 /label=ZraI /note="ZraI"
This page is informational only.