Basic Vector Information
- Vector Name:
- pCVD046
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7140 bp
- Type:
- Broad host range vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
pCVD046 vector Map
pCVD046 vector Sequence
LOCUS 40924_49212 7140 bp DNA circular SYN 18-DEC-2018
DEFINITION Broad host range vector vector pCVD046, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7140)
AUTHORS Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B,
Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
TITLE Broad-host-range vector system for synthetic biology and
biotechnology in cyanobacteria
JOURNAL Nucleic Acids Res. (2014) In press
PUBMED 25074377
REFERENCE 2 (bases 1 to 7140)
AUTHORS Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B,
Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW.
TITLE Direct Submission
JOURNAL Submitted (17-JUN-2014) Division of Biological Sciences, University
of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA
REFERENCE 3 (bases 1 to 7140)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7140)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res. (2014) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-JUN-2014) Division of Biological Sciences, University of
California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7140
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(124..981)
/label=AmpR
/note="beta-lactamase"
promoter complement(982..1086)
/label=AmpR promoter
misc_feature 1112..1117
/label=ZraI
/note="ZraI"
misc_feature 1227..1232
/label=ZraI
/note="ZraI"
misc_feature 1230..1250
/note="G5C5; GC-adaptor for seamless assembly, flanking a
BHR replicons, neutral sites, or cyanobacterial replicons;
synthetic"
misc_feature 1251..1256
/label=XbaI
/note="XbaI"
regulatory 1288..1314
/note="trpA T; trpA terminator from Lorist6 INSD accession
X98450, one nt shorter than reference; Lorist6"
/regulatory_class="terminator"
CDS complement(1650..2498)
/label=RSF1010 RepC
/note="replication protein C of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS complement(2488..3324)
/label=RSF1010 RepA
/note="replication protein A of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS complement(3354..3560)
/codon_start=1
/product="repF"
/label=repF
/note="repF-RSF1010; replication gene; derived from
pRL1383a in INSD accession AF403426, a derivative of
RSF1010 INSD accession M28829"
/protein_id="AII99697.1"
/translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDEY
EALRECLEELRAAQGGGSDPASA"
CDS complement(3562..3774)
/codon_start=1
/product="repE"
/label=repE
/note="repE-RSF1010; replication gene; derived from
pRL1383a in INSD accession AF403426, a derivative of
RSF1010 INSD accession M28829"
/protein_id="AII99698.1"
/translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMAS
LNLDGCTLSLFREDKPFGPGKFLGD"
regulatory complement(3804..3831)
/note="P4; derived from pRL1383a in INSD accession
AF403426, a derivative of RSF1010 INSD accession M28829;
the P4 promoter is under the auto-regulated control of the
F repressor, whose gene is located in the same operon,
providing transcription of E-F-repA-repC-operon"
/regulatory_class="promoter"
CDS complement(3838..4806)
/label=RSF1010 RepB
/note="replication protein B of the broad-host-range
plasmid RSF1010 (Scholz et al., 1989)"
CDS complement(4803..5216)
/codon_start=1
/product="mobB"
/label=mobB
/note="mobilization gene; derived from pRL1383a in INSD
accession AF403426, a derivative of RSF1010 INSD accession
M28829"
/protein_id="AII99695.1"
/translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTKQAS
EAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLASM
MPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
misc_feature 5662..5667
/label=AgeI
/note="AgeI"
oriT complement(6045..6132)
/direction=LEFT
/label=RSF1010 oriT
/note="origin of transfer of the broad-host-range plasmid
RSF1010 (Scholz et al., 1989)"
regulatory complement(6141..6172)
/note="P1; derived from pRL1383a in INSD accession
AF403426, a derivative of RSF1010 INSD accession M28829;
the P1 promoter is controlled by MobC and MobA provide
transcription of mobA/repB, mobB, and, probably,
E-F-repA-repC-operon"
/regulatory_class="promoter"
CDS 6163..6447
/codon_start=1
/product="mobC"
/label=mobC
/note="mobilization gene; derived from pRL1383a in INSD
accession AF403426, a derivative of RSF1010 INSD accession
M28829"
/protein_id="AII99694.1"
/translation="MVKGSNKAADRLAKLEEQRARINAEIQRERAREQQQERKNETRRK
VLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
rep_origin 6474..6868
/label=RSF1010 oriV
/note="replication origin of the broad-host-range plasmid
RSF1010; requires the RSF1010 RepA/B/C proteins for
replication (Scholz et al., 1989)"
terminator complement(7035..7078)
/label=bacterial terminator
/note="putative bacterial transcription terminator"
regulatory complement(7044..7072)
/note="TrrnC; rrnC terminator from Lorist6 INSD accession
X98450; Lorist6"
/regulatory_class="terminator"
misc_feature 7111..7116
/label=NheI
/note="NheI"
misc_feature 7117..7137
/note="GC; GC-adaptor for seamless assembly, flanking BHR
replicons or neutral sites; synthetic"
misc_feature 7135..7140
/label=ZraI
/note="ZraI"
This page is informational only.