pCVD012 vector (V001569)

Basic Vector Information

Vector Name:
pCVD012
Antibiotic Resistance:
Ampicillin
Length:
3400 bp
Type:
Broad host range vector
Replication origin:
ori
Source/Author:
Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.

pCVD012 vector Map

pCVD0123400 bp6001200180024003000M13 fwdT7 promoterCVD-ANTR; device for the GC-adaptor assembly: antibiotic resistance markersoriAmpRAmpR promoter

pCVD012 vector Sequence

LOCUS       40924_49072        3400 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Broad host range vector vector pCVD012, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3400)
  AUTHORS   Taton A, Unglaub F, Wright NE, Zeng WY, Paz-Yepez J, Brahamsha B, 
            Palenik B, Peterson TC, Haerizadeh F, Golden SS, Golden JW.
  TITLE     Broad-host-range vector system for synthetic biology and 
            biotechnology in cyanobacteria
  JOURNAL   Nucleic Acids Res. (2014) In press
  PUBMED    25074377
REFERENCE   2  (bases 1 to 3400)
  AUTHORS   Taton A, Unglaub F, Wright N, Zeng WY, Paz Yepes J, Brahamsha B, 
            Palenik B, Peterson T, Haerizadeh F, Golden SS, Golden JW.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUN-2014) Division of Biological Sciences, University 
            of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA
REFERENCE   3  (bases 1 to 3400)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3400)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic 
            Acids Res. (2014) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (17-JUN-2014) Division of Biological Sciences, University of 
            California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3400
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     293..309
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        320..338
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    370..375
                     /label=EcoRV
                     /note="EcoRV"
     misc_feature    complement(373..1425)
                     /note="CVD-ANTR; device for the GC-adaptor assembly:
                     antibiotic resistance markers"
     misc_feature    complement(373..393)
                     /note="C2G; GC-adaptor for seamless assembly, flanking 
                     antibiotic resistance markers, functional devices or custom
                     sequences; synthetic"
     misc_feature    394..399
                     /label=AgeI
                     /note="AgeI"
     regulatory      406..562
                     /note="PnptII; upstream region of nptII ORF including
                     promoter and RBS in INSD accession V00618; derived from 
                     pAM505"
                     /regulatory_class="promoter"
     CDS             563..1354
                     /codon_start=1
                     /product="nptII_A7120"
                     /label=nptII_A7120
                     /note="confers kanamycin resistance; aminoglycoside 
                     phosphotransferase"
                     /protein_id="AII99780.1"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     regulatory      1363..1389
                     /note="trpA T; trpA terminator from Lorist6 INSD accession 
                     X98450, one nt shorter than reference; Lorist6"
                     /regulatory_class="terminator"
     misc_feature    1399..1404
                     /label=NheI
                     /note="NheI"
     misc_feature    complement(1405..1425)
                     /note="GC; GC-adaptor for seamless assembly, flanking
                     antibiotic resistance markers or Escherichia coli origins 
                     to be assembled with a cyanobacterial replicon; synthetic"
     misc_feature    1423..1428
                     /label=EcoRV
                     /note="EcoRV"
     rep_origin      complement(1653..2241)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2415..3272)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(3273..3377)
                     /label=AmpR promoter

This page is informational only.