Basic Vector Information
- Vector Name:
- TRMPVIR
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9173 bp
- Type:
- Retroviral Tet-shRNA expression vector
- Replication origin:
- ori
- Source/Author:
- Zuber J, McJunkin K, Fellmann C, Dow LE, Taylor MJ, Hannon GJ, Lowe SW.
- Promoter:
- mPGK
TRMPVIR vector Map
TRMPVIR vector Sequence
LOCUS 40924_48972 9173 bp DNA circular SYN 18-DEC-2018 DEFINITION Retroviral Tet-shRNA expression vector TRMPVIR, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9173) AUTHORS Zuber J, McJunkin K, Fellmann C, Dow LE, Taylor MJ, Hannon GJ, Lowe SW. TITLE Toolkit for evaluating genes required for proliferation and survival using tetracycline-regulated RNAi JOURNAL Nat. Biotechnol. (2010) In press PUBMED 21131983 REFERENCE 2 (bases 1 to 9173) AUTHORS Zuber J, McJunkin K, Fellmann C, Dow LE, Taylor MJ, Hannon GJ, Lowe SW. TITLE Direct Submission JOURNAL Submitted (01-NOV-2010) Scott Lowe Lab, Cold Spring Harbor Laboratory, 1 Bungtown Road, Cold Spring Harbor, NY 11724, USA REFERENCE 3 (bases 1 to 9173) TITLE Direct Submission REFERENCE 4 (bases 1 to 9173) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Biotechnol. (2010) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-NOV-2010) Scott Lowe Lab, Cold Spring Harbor Laboratory, 1 Bungtown Road, Cold Spring Harbor, NY 11724, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9173 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 5..309 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 310..513 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" LTR 514..689 /label=5' LTR (truncated) /note="truncated long terminal repeat from Moloney murine sarcoma virus" misc_feature 752..951 /label=MMLV Psi /note="packaging signal of Moloney murine leukemia virus (MMLV)" CDS 1152..1568 /codon_start=1 /label=gag (truncated) /note="truncated Moloney murine leukemia virus (MMLV) gag gene lacking the start codon" /translation="GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTF NVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKP PPPLPPSAPSLPLEPPRSTPPRSSLYPALTPSLGA" protein_bind 1618..1888 /label=tetracycline response element /note="contains seven copies of the tetracycline operator tetO" promoter 1921..1959 /label=minimal CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 2058..2732 /codon_start=1 /label=DsRed2 /note="improved tetrameric variant of DsRed fluorescent protein" /translation="MASSENVITEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVK LKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV ATVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGETHK ALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDAKLDITSHNEDYTIVEQYERTEGRHH LFL" ncRNA 2804..2925 /label=5' miR-30a /note="sequence upstream of the 71-nt precursor of the human miR-30a microRNA (Zeng et al., 2002)" ncRNA 2953..2967 /label=miR-30a loop /note="loop from the the 71-nt precursor of the human miR-30a microRNA (Zeng et al., 2002)" /ncRNA_class="miRNA" ncRNA 2995..3121 /label=3' miR-30a /note="sequence downstream of the 71-nt precursor of the human miR-30a microRNA (Zeng et al., 2002)" promoter 3144..3643 /label=PGK promoter /note="mouse phosphoglycerate kinase 1 promoter" CDS 3666..4382 /codon_start=1 /label=Venus /note="yellow fluorescent protein (YFP) with fast and efficient maturation (Nagai et al., 2002)" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" misc_feature 4402..4977 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 4978..5721 /codon_start=1 /label=rtTA-Advanced /note="improved tetracycline-controlled transactivator" /translation="MSRLDKSKVINGALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHV KNKRALLDALPIEMLDRHHTHFCPLEGESWQDFLRNNAKSYRCALLSHRDGAKVHLGTR PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEEQEHQVAKEERETPTT DSMPPLLRQAIELFDRQGAEPAFLFGLELIICGLEKQLKCESGGPTDALDDFDLDMLPA DALDDFDLDMLPADALDDFDLDMLPG" LTR 5879..6304 /label=3' LTR (Delta-U3) /note="self-inactivating 3' long terminal repeat (LTR) from Moloney murine leukemia virus" promoter 6570..6899 /label=SV40 promoter /note="SV40 enhancer and early promoter" rep_origin complement(7192..7780) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7954..8811) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(8812..8916) /label=AmpR promoter enhancer 9102..9173 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer"
This page is informational only.