Basic Vector Information
- Vector Name:
- TKVBL-GVB
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7480 bp
- Type:
- Retrofitting vector
- Replication origin:
- oriV
- Source/Author:
- Kondo S, Booker M, Perrimon N.
- Promoter:
- copia
TKVBL-GVB vector Vector Map
TKVBL-GVB vector Sequence
LOCUS 40924_48937 7480 bp DNA circular SYN 18-DEC-2018 DEFINITION Retrofitting vector TKVBL-GVB, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7480) AUTHORS Kondo S, Booker M, Perrimon N. TITLE Cross-species RNAi rescue platform in Drosophila melanogaster JOURNAL Genetics 183 (3), 1165-1173 (2009) PUBMED 19720858 REFERENCE 2 (bases 1 to 7480) AUTHORS Kondo S, Booker M, Perrimon N. TITLE Direct Submission JOURNAL Submitted (19-FEB-2009) Department of Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA REFERENCE 3 (bases 1 to 7480) TITLE Direct Submission REFERENCE 4 (bases 1 to 7480) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genetics"; date: "2009"; volume: "183"; issue: "3"; pages: "1165-1173" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-FEB-2009) Department of Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7480 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 1107..1140 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." protein_bind 1457..1886 /label=gypsy insulator /note="chromatin insulator from Drosophila" polyA_signal complement(1894..2028) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(2360..2755) /codon_start=1 /label=BSD /note="blasticidin S deaminase" /translation="MAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTG VNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGI KAIVKDSDGQPTAVGIRELLPSGYVWEG" promoter complement(2772..3051) /label=copia promoter /note="strong promoter from the Drosophila transposable element copia (Sinclair et al., 1986)" polyA_signal complement(3171..3252) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(3381..4097) /codon_start=1 /label=Venus /note="yellow fluorescent protein (YFP) with fast and efficient maturation (Nagai et al., 2002)" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" protein_bind 4635..5019 /label=gypsy insulator /note="chromatin insulator from Drosophila" CDS complement(5391..6203) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 6327..6962 /label=oriV /note="incP origin of replication" protein_bind 6997..7066 /label=attB /note="attB site for the phi-C31 integrase (Groth et al., 2000)" mobile_element complement(7292..7457) /label=Tn7L /note="mini-Tn7 element (left end of the Tn7 transposon)"
This page is informational only.