Basic Vector Information
- Vector Name:
- SBa_000559
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5208 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Temme K, Zhao D, Voigt CA.
- Promoter:
- araBAD
SBa_000559 vector Map
SBa_000559 vector Sequence
LOCUS 40924_48753 5208 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector SBa_000559, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5208) AUTHORS Temme K, Zhao D, Voigt CA. TITLE Refactoring the nitrogen fixation gene cluster from Klebsiella oxytoca JOURNAL Proc. Natl. Acad. Sci. U.S.A. 109 (18), 7085-7090 (2012) PUBMED 22509035 REFERENCE 2 (bases 1 to 5208) AUTHORS Temme K, Zhao D, Voigt CA. TITLE Direct Submission JOURNAL Submitted (05-APR-2012) Biological Engineering, MIT, 500 Technology Square, Cambridge, MA 02139, USA REFERENCE 3 (bases 1 to 5208) TITLE Direct Submission REFERENCE 4 (bases 1 to 5208) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2012"; volume: "109"; issue: "18"; pages: "7085-7090" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-APR-2012) Biological Engineering, MIT, 500 Technology Square, Cambridge, MA 02139, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5208 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 43..64 /label=BioBrick prefix /note="BioBrick prefix for parts that do not start with 'ATG'" promoter 64..348 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" protein_bind 377..395 /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes" CDS 456..1166 /codon_start=1 /label=lambda repressor /note="phage lambda repressor" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV VGKVIASQWPEETFG" CDS 1167..1199 /codon_start=1 /label=ssrA tag (LVA) /note="C-terminal peptide that mediates degradation in bacteria through the ClpXP and ClpAP proteases (McGinness et al., 2006)" /translation="AANDENYALVA" terminator 1247..1318 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 1334..1361 /label=T7Te terminator /note="phage T7 early transcription terminator" CDS 1435..2310 /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" CDS 2340..2960 /codon_start=1 /label=TetR /note="tetracycline repressor TetR" /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV KNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTR PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTT DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS" misc_feature 2967..2987 /label=BioBrick suffix /note="universal suffix for all parts" terminator 2988..3047 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." rep_origin complement(3294..3881) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(3969..4063) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(4087..4944) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4945..5016) /label=AmpR promoter terminator complement(join(5205..5208,1..40)) /label=bacterial terminator /note="putative bacterial transcription terminator"
This page is informational only.