Basic Vector Information
- Vector Name:
- pZJ16
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10036 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Host:
- Yeast
- Source/Author:
- Zhou J, Olson DG, Lanahan AA, Tian L, Murphy SJ, Lo J, Lynd LR.
- Promoter:
- URA3
pZJ16 vector Map
pZJ16 vector Sequence
LOCUS 40924_48473 10036 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pZJ16, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10036) AUTHORS Zhou J, Olson DG, Lanahan AA, Tian L, Murphy SJ, Lo J, Lynd LR. TITLE Physiological roles of pyruvate ferredoxin oxidoreductase and pyruvate formate-lyase in Thermoanaerobacterium saccharolyticum JW/SL-YS485 JOURNAL Biotechnol Biofuels 8, 138 (2015) PUBMED 26379770 REFERENCE 2 (bases 1 to 10036) AUTHORS Zhou J. TITLE Direct Submission JOURNAL Submitted (27-OCT-2014) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 10036) TITLE Direct Submission REFERENCE 4 (bases 1 to 10036) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol Biofuels 8, 138 (2015)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-OCT-2014) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..10036 /mol_type="other DNA" /organism="synthetic DNA construct" oriT complement(347..456) /direction=LEFT /label=oriT /note="incP origin of transfer" terminator complement(877..904) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(996..1082) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" misc_feature 1144..2123 /label=upstream of Tsac_1064 /note="upstream of Tsac_1064" CDS 2273..3331 /codon_start=1 /gene="pta" /product="phosphate acetyltransferase" /label=pta /note="negative selective marker in Thermoanaerobacter saccharolyticum" /protein_id="AJP77036.1" /translation="MYTIYFFLVRGMYKNKYFKGRDDLMSIIQNIIEKAKSDKKKIVLP EGAEPRTLKAAEIVLKEGIADLVLLGNEDEIRNAAKDLDISKAEIIDPVKSEMFDRYAN DFYELRKNKGITLEKARETIKDNIYFGCMMVKEGYADGLVSGAIHATADLLRPAFQIIK TAPGAKIVSSFFIMEVPNCEYGENGVFLFADCAVNPSPNAEELASIAVQSANTAKNLLG FEPKVAMLSFSTKGSASHELVDKVRKATEIAKELMPDVAIDGELQLDAALVKEVAELKA PGSKVAGCANVLIFPDLQAGNIGYKLVQRLAKANAIGPITQGMGAPVNDLSRGCSYRDI VDVIATTAVQAQ" gene 2273..3331 /gene="pta" /label=pta CDS 3349..4560 /codon_start=1 /gene="ack" /product="acetate kinase" /label=ack /note="negative selective marker in Thermoanaerobacter saccharolyticum" /protein_id="AJP77035.1" /translation="MKIMKILVINCGSSSLKYQLIESTDGNVLAKGLAERIGINDSMLT HNANGEKIKIKKDMKDHKDAIKLVLDALVNSDYGVIKDMSEIDAVGHRVVHGGESFTSS VLINDEVLKAITDCIELAPLHNPANIEGIKACQQIMPNVPMVAVFDTAFHQTMPDYAYL YPIPYEYYTKYRIRRYGFHGTSHKYVSNRAAEILNKPIEDLKIITCHLGNGSSIAAVKY GKSIDTSMGFTPLEGLAMGTRSGSIDPSIISYLMEKENISAEEVVNILNKKSGVYGISG ISSDFRDLEDAAFKNGDERAQLALNVFAYRVKKTIGAYAAAMGGVDVIVFTAGVGENGP EIREFILDGLEFLGFSLDKEKNKVRGKETIISTPNSKVSVMVVPTNEEYMIAKDTEKIV KSIK" gene 3349..4560 /gene="ack" /label=ack regulatory 4688..5218 /label=kanamycin promoter /note="kanamycin promoter" /regulatory_class="promoter" CDS 5219..6010 /label=KanR /note="aminoglycoside phosphotransferase" misc_feature 6349..7260 /label=downstream of Tsac_1067 /note="downstream of Tsac_1067" rep_origin complement(7670..8215) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 8327..8355 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS complement(8432..9232) /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(9233..9453) /label=URA3 promoter misc_feature 9481..9984 /label=CEN/ARS /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.